In Silico Characterization and Structural Modeling of Dermacentor andersoni p36 Immunosuppressive Protein.
1. IntroductionTicks are considered among the most important vectors of livestock diseases worldwide as well as major vectors of pet diseases [1]. In tropical Africa, ticks and the tick-transmissible diseases constitute a major obstacle to livestock development [2]. Like elsewhere in the world, chemical acaricides have been the mainstay of tick control in this region; however, increasing resistance to this group of insecticides threatens livestock production systems, especially small-holding sectors that rely on rearing of exotic cattle breeds that are more susceptible to tick infestation and tick-borne diseases [TBDs] [3]. Integrated tick control incorporating reduced acaricide use, breeding cattle for tick resistance, rotational grazing, and use of vaccines presents a sustainable and long-term strategy to the control of ticks and TBDs in the tropics [4].
Numerous studies have shown the potential of immunological methods to control tick infestation by targeting critical tick physiological processes. Existing antitick vaccines work by eliciting humoral and cellular responses against tick cell membrane antigens [5, 6]. Vaccines capable of quelling both the arthropod vector and disease-causing pathogens are also under development [7]. Despite clear advantages of controlling ticks through vaccination, this strategy is presently hampered by antigenic sequence variations between geographically isolated tick populations and species causing vaccine resistance in some regions [8] and lack of efficacy in others [9]. These limitations necessitate search of alternative antigens for inclusion in the next-generation tick vaccines.
Proteins found in tick saliva play critical roles during blood meal acquisition [10]. The pharmacologically active components secreted in their saliva help ticks circumvent host defenses such as haemostatic and immune responses of the host, thereby enabling blood feeding in hematophagous arthropods [11]. One such class of biological compounds is immunosuppressant proteins, which modulate the host's immune system during tick's blood feeding [12], making them suitable target in the search of novel vaccines against arthropod-transmitted diseases [13]. Low molecular weight proteins 5-36 kDa from tick saliva proteins have been shown to inhibit T-lymphocytes proliferation in vitro [14]. Active immunization of mice with Salp15, a 15 kDa secreted salivary gland protein from I. scapularis, showed substantial protection (60%) from tick-borne Borrelia [15]. Tick subolesin (SUB), the ortholog of insect and vertebrate akirins (AKR), was discovered as a tick protective antigen in Ixodes scapularis [16]. Vaccines containing conserved SUB/AKR protective epitopes have been shown to protect against tick, mosquito, and sandfly infestations, thus suggesting the possibility of developing universal vaccines for the control of arthropod vector infestations [17].
Protein antigens conserved across vector species could be used in developing cross-protective vaccines against multiple arthropod vectors and their associated pathogens [17, 18]. Alarcon-Chaidez et al. [19] cloned and characterized a 36 kDa immunosuppressive protein p36 from the salivary glands of partially engorged, female D. andersoni, that suppressed Con-A induced in vitro proliferation of normal murine T-lymphocytes by more than 90% [20]. Genes related to D. andersoni-derived p36 gene, such as Ra-p36, Av-p36, Hl-p36, and Rhp36, have been reported in A. variegatum [21], R. appendiculatus [22], H. longicornis [23], and R. haemaphysaloides [24]. Most proteins are, however, not sufficiently protective on their own suggesting the need for a multiantigen/chimeric vaccine that incorporates critical tick and pathogen antigenic epitopes [16, 25] to elicit synergistic antipathogen and antitick immune responses. Computational characterization and 3D structure modeling of D. andersoni p36 protein undertaken by this study is an initial step in understanding molecular basis of immune recognition which is a challenge in vaccine development [26]. The p36 conserved antigenic region predicted by this study has binding residues for ligands like glycerol and lactose which are associated with an immunomodulatory role suggesting this site may have a role in suppression of select T-cell receptor induced signaling events of D. andersoni p36 and its related proteins.
2. Methods
2.1. Sequence Characterization of Tick p36 Proteins. All tick proteins deposited in National Centre for Biotechnology Information (NCBI) (https://www.ncbi.nlm.nih.gov) protein database were retrieved and deposited in a standalone MySQL based database (https://www.mysql.com). D. andersoni p36 protein was used as reference sequence in conducting homology searches, Blastp [27] and OrthoMCL [28, 29], of tick proteins in the database.
The identified tick p36-related proteins were subjected to MEME tool search (http://meme-suite.org/tools/meme) to predict conserved motifs characteristic of p36 proteins. Motif search tool (http://www.genome.jp/tools/motif) then searched for function of identified common motifs in the database of known motifs. Tick p36 protein sequences were then aligned by a multiple sequence alignment tool, Clustal Omega (https://www.ebi.ac.uk/Tools/msa/clustalo). Phylogenetic tree construction was by maximum likelihood method [30] and evolutionary distance computed using Poisson correction method [31]. Bootstrap resampling (1000 replicates) assessed robustness of the groupings.
2.2. Identification of Antigenic Determinants in the p36 Proteins. SignalP 4.1 (http://www.cbs.dtu.dk/services/SignalP), TMHMM (http://www.cbs.dtu.dk/services/TMHMM), and PredGPI (http://gpcr.biocomp.unibo.it/predgpi) servers were used to determine if tick p36 proteins are preferably secretory, transmembrane, or have a glycosylphosphatidylinositol (GPI) sites, respectively. Antigenic potentials of tick p36 proteins against reference Bm86, a known antitick vaccine antigen, were evaluated by vaxijen tool (http://www.ddgpharmfac.net/vaxijen/VaxiJen/VaxiJen.html); the model selected was parasite whose standard threshold is 0.5000. The antigenic regions of D. andersoni p36 and other p36 proteins predicted with an antigenic score above 0.7000 were mapped by online tools that predict antigenic peptides (Immunomedicine) (http://imed.med.ucm.es/Tools/antigenic.pl) and SVMTrip [32]. Immunogenic segments/residues of the predicted antigenic region were identified by an online Epitopia tool (http://epitopia.tau.ac.il). Sprint-Pep tool (http://sparks-lab.org/server/SPRINT) was then used to predict protein-peptide binding sites while Coach tool (https://zhanglab.ccmb.med.umich.edu/COACH) predicted ligands likely to bind these sites found within the region predicted as a potential p36 protein conserved site.
2.3. Structural Modeling of D. andersoni p36 Protein. Physicochemical properties of D. andersoni p36 protein were analyzed by ExPASyProtParam (https://www.expasy.org) server while its secondary structure was characterized by online tool [Spider.sup.2] (http://sparks-lab.org/yueyang/server/ SPIDER2). The crystal or NMR structure of tick p36 protein is currently not available in the protein data bank (PDB) (https://www.rcsb.org/pdb/). The 3D structure of D. andersoni p36 protein was developed by QUARK ab initio modeling [33] that builds 3D structure from "Scratch," based on physical principles rather than previously solved structures. 10 models, designated as 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10, were generated and validated by analyzing Verify 3D scores [34] of Ramachandran plots for each model. Based on the scores, models 2 and 9 were selected as likely 3D structures of D. andersoni p36 protein because they scored 81.41% and 88.44%, respectively, meeting Verify 3D validation tool limit of 80% of the amino acids residues scoring >=0.2 in the 3D/1D profile.
The two selected models had their atomic structures refined by ModRefiner [35] after which their respective generated Ramachandran plots were validated by RAMPAGE (http://mordred.bioc.cam.ac.uk/~rapper/rampage.php) and ProQ (https://proq.bioinfo.se/ProQ/ProQ.html). The validation scores guided selection of model 2 as the best 3D structure of D. andersoni p36 protein. PDBsum (https://www .ebi.ac.uk/thornton-srv/ databases/cgi-bin/pdbsum/GetPage .pl?pdbcode=index.html) was used to check location of predicted conserved antigenic region in the 3D structure of D. andersoni p36 protein.
3. Results and Discussion
3.1. Identification and Phylogenetic Analysis of p36 Proteins from Ixodid Ticks. The study identified 32 homologs of D. andersoni p36 protein among 6 ixodid (hard) tick species (Table 1). These included p36 genes reported in earlier studies from R. appendiculatus, A. variegatum, H. longicornis, and Rhipicephalus haemaphysaloides tick species as well as those found by this study in Amblyomma sculptum and Amblyomma aureolatum. Among these homologs, 4 co-orthologs which are potential orthologs of D. andersoni p36 protein were identified in R. appendiculatus species (Table 1). Occurrence of p36 protein across a range of tick species may be related to a biological function for this protein in tick feeding [36]. Several p36 immunosuppressant protein sequences were found in a single tick species suggesting functional and structural redundancy in which a tick expresses multiple similar proteins in minute quantities during feeding [37]. Such redundancy may render saliva proteins less immunogenic, as reported with cystatins [38].
The tick p36 proteins have 3 potential common motifs designated as 1, 2, and 3 with motif 2 being the only one conserved among p36 proteins (Figure 1). Motif 2 is located between amino acid positions "107-127" in the reference D. andersoni p36 protein. This motif 2 may be associated with a functional domain, possibly a role in immunomodulatory activity of tick p36 proteins [39]. The 3 common motifs were not found in the motif database and could be representing an orphan protein family [40].
Alignment of tick p36 proteins revealed a conserved region occurring between amino acid positions "107-115" ("IDKGMLSPF") in the reference D. andersoni p36 protein (Figure 2). This region that coincides with location of conserved motif 2 has polar amino acid residue serine (S) and charged residues lysine (K) and aspartate (D), which are associated with potential active sites [41]. Phylogenetic tree (Figure 3) showed that, among homologs with higher amino acid percentage similarity and E-scores, D. andersoni was closely related to homologs from R. haemophysaloides and R. appendiculatus as compared to homolog from A. variegatum indicating more recent ancestry between Dermacentor and Rhipicephalus than with Amblyomma genera as inferred by phylogeny [42].
3.2. Identification and Characterization of Antigenic Regions in the p36 Proteins. Most tick p36 proteins were predicted as secretory with signal peptide cleavage site at position 21-22 (Supplementary Table S1 and Figure S1). Secretory proteins are favoured candidates for vaccine development as they are easily accessible microbial antigens to the immune system [43]. D. andersoni p36 protein and most p36 variants were predicted as antigenic with several homologs having antigenicity score above 0.7000 (Table 2, Supplementary Table S1), surpassing the vaxijen tool threshold of 0.5000. JAP81944.1, a homolog in R. appendiculatus had antigenicity score of 0.7701, comparably higher than that of Bm86 (0.7681), the constituent antigen of Tickgard and Gavac[TM] commercial tick vaccines. Whether this theoretically predicted immunogenicity can confer protection against tick infestation there is need to be evaluated empirically through an immunization/tick challenge set up.
The potentially conserved motif 2 in p36 protein was predicted as a likely epitope-rich antigenic region with binding residues for glycerol and lactose ligands which are associated with an immunomodulatory role [44, 45]. To facilitate tick feeding a single tick saliva protein ligand may bind receptors on several immune cell types in the vertebrate host; alternatively, multiple tick saliva proteins may bind to a common receptor [37].
3.3. 3D Structure of D. andersoni p36 Protein. D. andersoni p36 protein has an instability index of 35.53 and GRAVY score of -0.324 classifying it as a stable, globular protein [46]. The protein's high aliphatic index of 86.41 is associated with increase in thermostability of globular protein [47]. The stable secondary structures alpha-helix (a) and beta-sheets ([beta]) comprised approximately 55% of D. andersoni p36 protein amino acid sequence (Supplementary Figure S2). The predicted conserved immunogenic region "74-107" in processed secretory D. andersoni p36 protein had several segments within loop regions where epitopes are generally found [48]. The combination of [alpha]-helixes and [beta]-structures through loops with specific geometric arrangements with respect to each is responsible in forming conserved structural motifs [49, 50].
Based on Verify 3D [34] scores of the 10 models designated as 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10 generated for D. andersoni p36 protein; models 2 and 9 were selected for further validation as they passed tool limit of 80% of the amino acids residues scoring >=0.2 in the 3D/1D profile (Supplementary Table S2). Comparison of validation scores of the selected models 2 and 9 (Table 3, Supplementary Figures S3 and S4) identified model 2 as the best 3D structure of D. andersoni p36 protein.
The predicted 3D structure of D. andersoni p36 protein (Figures 4(a) and 4(b)) is a ball-like structure comprised of 1 alpha-helix and several antiparallel beta-strands. The region predicted as a likely conserved antigenic region "74 ... 107" in D. andersoni p36 protein is not only located in between the alpha-helix and beta-strands but also occurs within the potentially groove region of the predicted 3D structure and further has its loop exposed on the protein surface (Figure 4(c)). Ligands bind in the largest cleft in over 83% of the proteins [51]; thus presence of the predicted conserved antigenic region within this potential groove may be associated with immunosuppressive function of D. andersoni p36 protein, as internal cavities in proteins are important structural elements that may produce functional motions such as ligand binding [52].
Potentially exposed loop region "87 ... 94" (Figure 4(d)) in predicted 3D structure of D. andersoni p36 protein coincides with its likely conserved alignment region "107 ... 115" after cleavage of signal peptide at amino acid position 21-22. This suggested loop region might be associated with binding site of D. andersoni p36 protein. The ligands predicted with potential to bind on this site include fatty acid glycerol and sugars like lactose. The hydroxyl group of polar amino acid residue serine (S), hydrophobic amino acid residue leucine (L), and charged amino acids lysine (K) and aspartic acid (D) found in this region could, respectively, have a role in binding of these ligands [53]. Immunomodulator ligands predicted with potential of binding at this site include fatty acid glycerol and sugars like lactose. There is need for future studies to evaluate whether immunomodulator ligands have a role in suppression of select T-cell receptor (TCR) induced signaling events in D. andersoni p36 protein mode of action [44, 45].
Collectively results from this in silico study provide further insight into potential characters of p36 protein, which is vital in exploiting the proteins as targets for developing improved next-generation cross-protective tick control approaches. In an effort to determine exact role of these proteins in tick feeding process, it is necessary for future laboratory and animal studies to confirm these preliminary predictive findings.
4. Conclusion
The p36 immunosuppressive proteins from ticks exhibit antigen traits worth evaluating in future experimental in vitro and in vivo trials. This includes potential conservation across several tick species and presence of a likely conserved antigenic region that may be bound by immunomodulator ligands such as glycerol and lactose. A further study is necessary on suitability of this potentially conserved region in development of a multi/chimeric antitick vaccine that incorporates critical antigenic regions. The predicted 3D model of D. andersoni p36 protein may be used as a template to model structures of other orphan proteins related to p36. This work is a step towards developing cross-protective next-generation antitick vaccines, as the results expand our knowledge of p36 tick saliva protein and lay ground for future studies to determine their exact role in tick feeding process, which is useful in designing blockade approaches targeting these proteins.
https://doi.org/10.1155/2018/7963401
Disclosure
This research did not receive any specific grant from funding agencies in the public, commercial, or non-profit sector.
Conflicts of Interest
The authors declare that there are no conflicts of interest.
Acknowledgments
The authors would like to thank CGIAR Fund Donors (http:// www.cgiar.org/who-we-are/cgiar-fund/fund-donors-2) for supporting the study.
Supplementary Materials
Supplementary Table S1: protein targeting pathway and antigenic potential of tick p36 proteins. Supplementary Table S2: Verify 3D validation scores of models generated for D. andersoni p36 protein. Supplementary Figure S1: D. andersoni p36 protein signal peptide cleavage site location. Supplementary Figure S2: Spider2 tool secondary structure characterization of D. andersoni p36 protein. Supplementary Figure S3: rampage tool assessment of Ramachandran plot for model 2 of D. andersoni p36 protein. Supplementary Figure S4: rampage tool assessment of Ramachandran plot for model 9 of D. andersoni p36 protein. (Supplementary Materials)
References
[1] J. De La Fuente, A. Estrada-Pena, J. M. Venzal, K. M. Kocan, and D. E. Sonenshine, "Overview: Ticks as vectors of pathogens that cause disease in humans and animals," Frontiers in Bioscience, vol. 13, no. 18, pp. 6938-6946, 2008.
[2] F. Jongejan and G. Uilenberg, "The global importance of ticks," Parasitology, vol. 129, supplement 1, pp. S3-S14, 2004.
[3] R. Z. Abbas, M. A. Zaman, D. D. Colwell, J. Gilleard, and Z. Iqbal, "Acaricide resistance in cattle ticks and approaches to its management: The state of play," Veterinary Parasitology, vol. 203, no. 1-2, pp. 6-20, 2014.
[4] J. Fuente, K. M. Kocan, and E. F. Blouin, "Tick vaccines and the transmission of tick-borne pathogens," Veterinary Research Communications, vol. 31, no. 1, pp. 85-90, 2007
[5] O. Merino, P. Alberdi, J. M. Perez De La Lastra, and J. de la Fuente, "Tick vaccines and the control of tick-borne pathogens," Frontiers in Cellular and Infection Microbiology, vol. 4, Article ID Article 30, 2013.
[6] J. De La Fuente and M. Contreras, "Tickvaccines: Current status and future directions," Expert Review of Vaccines, vol. 14, no. 10, pp. 1367-1376, 2015.
[7] D. P. Oldiges, J. M. Laughery, N. J. Tagliari et al., "Transfected Babesia bovis Expressing a Tick GST as a Live Vector Vaccine," PLOS Neglected Tropical Diseases, vol. 10, no. 12, Article ID e0005152, 2016.
[8] J. C. Garcia-Garcia, C. Montero, M. Redondo et al., "Control of ticks resistant to immunization with Bm86 in cattle vaccinated with the recombinant antigen Bm95 isolated from the cattle tick, Boophilus microplus," Vaccine, vol. 18, no. 21, pp. 2275-2287, 2000.
[9] D. Odongo, L. Kamau, R. Skilton et al., "Vaccination of cattle with TickGARD induces cross-reactive antibodies binding to conserved linear peptides of Bm86 homologues in Boophilus decoloratus," Vaccine, vol. 25, no. 7, pp. 1287-1296, 2007
[10] P. A. Nuttall, A. R. Trimnell, M. Kazimirova, and M. Labuda, "Exposed and concealed antigens as vaccine targets for controlling ticks and tick-borne diseases," Parasite Immunology, vol. 28, no. 4, pp. 155-163, 2006.
[11] A. Fontaine, A. Pascual, I. Diouf et al., "Mosquito salivary gland protein preservation in the field for immunological and biochemical analysis," Parasites & Vectors, vol. 4, no. 1, article no. 33, 2011.
[12] G. Leboulle, M. Crippa, Y. Decrem et al., "Characterization of a novel salivary immunosuppressive protein from Ixodes ricinus ticks," The Journal of Biological Chemistry, vol. 277, no. 12, pp. 10083-10089, 2002.
[13] R. G. Titus, J. V. Bishop, and J. S. Mejia, "The immunomodulatory factors of arthropod saliva and the potential for these factors to serve as vaccine targets to prevent pathogen transmission," Parasite Immunology, vol. 28, no. 4, pp. 131-141, 2006.
[14] J. Anguita, N. Ramamoorthi, J. W. R. Hovius et al., "Salp15, an Ixodes scapularis salivary protein, inhibits CD4+ T cell activation," Immunity, vol. 16, no. 6, pp. 849-859, 2002.
[15] J. Dai, P. Wang, S. Adusumilli et al., "Antibodies against a tick protein, Salp15, protect mice from the Lyme disease agent," Cell Host & Microbe, vol. 6, no. 5, pp. 482-492, 2009.
[16] C. Almazan, O. Moreno-Cantu, J. A. Moreno-Cid et al., "Control of tick infestations in cattle vaccinated with bacterial membranes containing surface-exposed tick protective antigens," Vaccine, vol. 30, no. 2, pp. 265-272, 2012.
[17] J. A. Moreno-Cid, J. M. Perez de la Lastra, M. Villar et al., "Control of multiple arthropod vector infestations with subolesin/akirin vaccines," Vaccine, vol. 31, no. 8, pp. 1187-1196, 2013.
[18] L. F. Parizi, N. W. Githaka, C. Logullo et al., "The quest for a universal vaccine against ticks: Cross-immunity insights," The Veterinary Journal, vol. 194, no. 2, pp. 158-165, 2012.
[19] F. J. Alarcon-Chaidez, U. U. Muller-Doblies, and S. Wikel, "Characterization of a recombinant immunomodulatory protein from the salivary glands of Dermacentor andersoni," Parasite Immunology, vol. 25, no. 2, pp. 69-77, 2003.
[20] D. K. Bergman, M. J. Palmer, M. J. Caimano, J. D. Radolf, and S. K. Wikel, "Isolation and molecular cloning of a secreted immunosuppressant protein from Dermacentor andersoni salivary gland," Journal of Parasitology, vol. 86, no. 3, pp. 516-525, 2000.
[21] V. Nene, D. Lee, J. Quackenbush et al., "AvGI, an index of genes transcribed in the salivary glands of the ixodid tick Amblyomma variegatum," International Journal for Parasitology, vol. 32, no. 12, pp. 1447-1456, 2002.
[22] V. Nene, D. Lee, S. Kang A et al., "Genes transcribed in the salivary glands of female Rhipicephalus appendiculatus ticks infected with Theileria parva," Insect Biochemistry and Molecular Biology, vol. 34, no. 10, pp. 1117-1128, 2004.
[23] S. Konnai, C. Nakajima, S. Imamura et al., "Suppression of cell proliferation and cytokine expression by HL-p36, a tick salivary gland-derived protein of Haemaphysalis longicornis," The Journal of Immunology, vol. 126, no. 2, pp. 209-219, 2009.
[24] F. Wang, X. Lu, F. Guo et al., "The immunomodulatory protein RH36 is relating to blood-feeding success and oviposition in hard ticks," Veterinary Parasitology, vol. 240, pp. 49-59, 2017
[25] L. F. Parizi, J. Reck, D. P. Oldiges et al., "Multi-antigenic vaccine against the cattle tick Rhipicephalus (Boophilus) microplus: A field evaluation," Vaccine, vol. 30, no. 48, pp. 6912-6917, 2012.
[26] D. W. Kulp and W. R. Schief, "Advances in structure-based vaccine design," Current Opinion in Virology, vol. 3, no. 3, pp. 322-331, 2013.
[27] S. F. Altschul, W. Gish, W. Miller, E. W. Myers, and D. J. Lipman, "Basic local alignment search tool," Journal of Molecular Biology, vol. 215, no. 3, pp. 403-410, 1990.
[28] S. Fischer, B. P. Brunk, F. Chen et al., "Using OrthoMCL to assign proteins to OrthoMCL-DB groups or to cluster proteomes into new ortholog groups," Current Protocols in Bioinformatics, Chapter 6, pp. 19-10, 2011.
[29] L. Li, C. J. Stoeckert Jr., and D. S. Roos, "OrthoMCL: identification of ortholog groups for eukaryotic genomes," Genome Research, vol. 13, no. 9, pp. 2178-2189, 2003.
[30] S. Whelan and N. Goldman, "A general empirical model of protein evolution derived from multiple protein families using a maximum-likelihood approach," Molecular Biology and Evolution, vol. 18, no. 5, pp. 691-699, 2001.
[31] E. Zuckerkandl and L. Pauling, Evolutionary divergence and convergence in proteins, E, 1965.
[32] B. Yao, L. Zhang, S. Liang, and C. Zhang, "SVMTriP: a method to predict antigenic epitopes using support vector machine to integrate tri-peptide similarity and propensity," PLoS ONE, vol. 7, no. 9, Article ID e45152, 2012.
[33] D. Xu and Y. Zhang, "Ab initio protein structure assembly using continuous structure fragments and optimized knowledge-based force field," Proteins: Structure, Function, and Bioinformatics, vol. 80, no. 7, pp. 1715-1735, 2012.
[34] D. Eisenberg, R. Luthy, and J. U. Bowie, "VERIFY3D: assessment of protein models with three-dimensional profiles," Methods in Enzymology, vol. 277, pp. 396-404, 1997.
[35] D. Xu and Y. Zhang, "Improving the physical realism and structural accuracy of protein models by a two-step atomic-level energy minimization," Biophysical Journal, vol. 101, no. 10, pp. 2525-2534, 2011.
[36] J. de la Fuente, C. Almazan, U. Blas-Machado et al., "The tick protective antigen, 4D8, is a conserved protein involved in modulation of tick blood ingestion and reproduction," Vaccine, vol. 24, no. 19, pp. 4082-4095, 2006.
[37] J. Chmelar, J. Kotal, J. Kopecky, J. H. F. Pedra, and M. Kotsyfakis, "All For One and One For All on the Tick-Host Battlefield," Trends in Parasitology, vol. 32, no. 5, pp. 368-377, 2016.
[38] C. K. Rangel, L. F. Parizi, G. A. Sabadin et al., "Molecular and structural characterization of novel cystatins from the taiga tick Ixodes persulcatus," Ticks and Tick-borne Diseases, vol. 8, no. 3, pp. 432-441, 2017
[39] R. D. Sleator and P. Walsh, "An overview of in silico protein function prediction," Archives of Microbiology, vol. 192, no. 3, pp. 151-155, 2010.
[40] D. Tautz and T. Domazet-Loso, "The evolutionary origin of orphan genes," Nature Reviews Genetics, vol. 12, no. 10, pp. 692-702, 2011.
[41] B. V. B. Reddy, W. W. Li, I. N. Shindyalov, and P. E. Bourne, "Conserved key amino acid positions (CKAAPs) derived from the analysis of common substructures in proteins," in Proteins: Structure, Function and Genetics, pp. 148-163, 2001.
[42] H. Hoogstraal and A. Aeschlimann, "Tick-Host Specificity. Bull. La Societe Entomol," Suisse, vol. 55, pp. 5-32, 1982.
[43] J. D. Bendtsen and K. G. Wooldridge, Bacterial secreted proteins: Secretory mechanisms and role in pathogenesis, Caister Academy Press, Norfolk, UK, 2009.
[44] M. S. Zhang, A. Sandouk, and J. C. D. Houtman, "Glycerol Monolaurate (GML) inhibits human T cell signaling and function by disrupting lipid dynamics," Scientific Reports, vol. 6, Article ID 30225, 2016.
[45] M. Paasela, K.-L. Kolho, O. Vaarala, and J. Honkanen, "Lactose inhibits regulatory T-cell-mediated suppression of effector T-cell interferon-y and IL-17 production," British Journal of Nutrition, vol. 112, no. 11, pp. 1819-1825, 2014.
[46] E. Gasteiger, C. Hoogland, A. Gattiker et al., "Protein Identification and Analysis Tools on the ExPASy Server," in The Proteomics Protocols Handbook, pp. 571-607, 2005.
[47] A. Ikai, "Thermostability and Aliphatic Index of Globular Proteins," The Journal of Biochemistry, pp. 1895-1898, 1980.
[48] G. A. Dalkas, F. Teheux, J. M. Kwasigroch, and M. Rooman, "Cation-re, amino-re, re-re, and H-bond interactions stabilize antigen-antibody interfaces," Proteins: Structure, Function, and Bioinformatics, vol. 82, no. 9, pp. 1734-1746, 2014.
[49] L. Cowen, P. Bradley, M. Menke, J. King, and B. Berger, "Predicting the beta-helix fold from protein sequence data," Journal of Computational Biology, vol. 9, no. 2, pp. 261-276, 2002.
[50] M. R. Conte, T. Grime, J. Ghuman et al., "Structure of tandem RNA recognition motifs from polypyrimidine tract binding protein reveals novel features of the RRM fold," EMBO Journal, vol. 19, no. 12, pp. 3132-3141, 2000.
[51] R. A. Laskowski, N. M. Luscombe, M. B. Swindells, and J. M. Thornton, "Protein clefts in molecular recognition and function," Protein Science, vol. 5, pp. 2438-2452, 1996.
[52] K. Ogata, C. Kanei-Ishii, M. Sasaki et al., "The cavity in the hydrophobic core of Myb DNA-binding domain is reserved for DNA recognition and trans-activation," Nature Structural & Molecular Biology, vol. 3, no. 2, pp. 178-187, 1996.
[53] M. R. Barnes and I. C. Gray, Bioinformatics for Geneticists, John Wiley & Sons, Ltd, Chichester, UK, 2003.
Martin Omulindi Oyugi (ID), (1) Johnson Kangethe Kinyua, (1) Esther Nkirote Magiri, (2) Milcah Wagio Kigoni, (3) Evenilton Pessoa Costa, (4) and Naftaly Wang'ombe Githaka (5)
(1) Department of Biochemistry, Jomo Kenyatta University of Agriculture and Technology, P.O. Box 62000, Nairobi 00200, Kenya
(2) Cooperative University of Kenya, P.O. Box 24814, Nairobi 00502, Kenya
(3) Department of Biochemistry, Kenyatta University, P.O. Box 43844, Nairobi 00100, Kenya
(4) Unit of Animal Experimentation, State University of North Fluminense, Centre of Biosciences and Biotechnology, Campos dos Goytacazes, RJ, Brazil
(5) Animal and Human Health Program, International Livestock Research Institute, P.O. Box 30709, Nairobi 00100, Kenya
Correspondence should be addressed to Martin Omulindi Oyugi; omulindimartin@gmail.com
Received 5 November 2017; Accepted 14 February 2018; Published 8 April 2018
Academic Editor: David A. McClellan
Caption: Figure 1: (a) Occurrence of tandem motifs among p36 proteins. Motif 2 is conserved across all homologs; (b) motifs sequence logo analysis.
Caption: Figure 3: Phylogenetic relatedness between p36 proteins. Bootstrap resampling (1000 replicates) was employed to validate the robustness of the groupings yielded.
Caption: Figure 4: (a, b) D. andersoni p36 protein predicted 3D structure ribbon and space field model; (c) predicted antigenic region "74-107," in 3D structure of D. andersoni p36 protein. (d) Topology of D. andersoni p36 protein showing the likely predicted conserved exposed loop. Yellow: predicted conserved antigenic region "74-107"; red: [alpha]-helix secondary structure; purple: [beta]-strands secondary structure. T: predicted exposed loop region "87-94" ("DKGMLSPF") in D. andersoni p36, showing conservation in alignment of tick p36 proteins.
Table 1: Tick proteins related to D. andersoni p36 protein.
Tick species NCBI Sequence similarity searches
accession Blastp homology search
number Protein description% identity
AlignmentE ValueBit score
length (aa)
D. andersoni AAF03683.1 p36 *
R. appendiculatus JAP82151.1 Da-p36 family member
R. appendiculatus JAP81510.1 Da-p36 family member
R. appendiculatus JAP87204.1 Da-p36 family member
R. appendiculatus JAP86350.1 Da-p36 family member
A. variegatum BAD11807.1 Da-p36
R. h. haemaphysaloides ABB90890.1 Rhh-ISP partial
A. sculptum JAU03129.1 Hypothetical protein partial
R. appendiculatus JAP81944.1 Da-p36 family member
R. appendiculatus JAP88013.1 Da-p36 family member partial
A. sculptum JAU02613.1 Hypothetical protein partial
R. appendiculatus JAP85022.1 Hypothetical protein
A. sculptum JAU02539.1 partial Da-p36 family member
A. variegatum DAA34595.1 Da-p36 like
A. aureolatum JAT98922.1 Hypothetical protein partial
A. aureolatum JAT98921.1 Hypothetical protein
R. appendiculatus JAP85729.1 Da-p36 family member
R. appendiculatus JAP85564.1 Da-p36 family member
R. appendiculatus JAP82143.1 Da-p36 family member
R. appendiculatus JAP86306.1 Da-p36 family member
R. appendiculatus JAP81863.1 Da-p36 family member
A. variegatum DAA34748.1 Da-p36 like
R. appendiculatus JAP78061.1 Da-p36 family member
R. appendiculatus JAP86680.1 Da-p36 family member
R. appendiculatus JAP88255.1 Da-p36 family member
R. appendiculatus JAP85730.1 Da-p36 family member
H. longicornis BAG11660.1 Isp-p36
R. appendiculatus JAP81735.1 Da-p36 family member
R. appendiculatus JAP86324.1 Da-p36 family member
A. sculptum JAU02519.1 Hypothetical protein partial
A. variegatum DAA34145.1 ISP-p36 partial
R. appendiculatus JAP81446.1 Da-p36 family member
R. appendiculatus JAP86032.1 Da-p36 family member
Tick species Sequence similarity searches
Blastp homology search
Protein description% identity
AlignmentE ValueBit score
length (aa)
D. andersoni 100 220 1.00E--165 459
R. appendiculatus 37.72 228 2.00E--034 124
R. appendiculatus 37.8 209 3.00E--034 123
R. appendiculatus 37.81 201 3.00E--033 120
R. appendiculatus 35.82 201 6.00E--032 116
A. variegatum 35.04 234 1.00E--029 111
R. h. haemaphysaloides 36.71 158 2.00E--027 103
A. sculptum 35.06 231 1.00E--026 103
R. appendiculatus 32.3 226 2.00E--024 97.4
R. appendiculatus 31.58 228 2.00E--024 97.4
A. sculptum 27.65 217 2.00E--016 74.3
R. appendiculatus 25.11 231 7.00E--016 72.8
A. sculptum 32 175 2.00E--015 70.9
A. variegatum 27.95 229 3.00E--015 70.9
A. aureolatum 31.65 218 4.00E--015 70.5
A. aureolatum 30.19 212 3.00E--013 65.5
R. appendiculatus 26.24 221 4.00E--013 65.1
R. appendiculatus 25.47 212 2.00E--012 63.5
R. appendiculatus 23.31 236 2.00E--011 60.1
R. appendiculatus 25.74 237 3.00E--011 60.1
R. appendiculatus 27.14 210 6.00E--011 59.3
A. variegatum 29.24 171 1.00E--010 57.8
R. appendiculatus 26.23 244 3.00E--009 54.3
R. appendiculatus 27.72 202 7.00E--009 53.5
R. appendiculatus 26.73 202 2.00E--008 52
R. appendiculatus 24.82 141 2.00E--008 51.2
H. longicornis 31.78 107 1.00--007 50.1
R. appendiculatus 24.58 240 6.00E--004 38.9
R. appendiculatus 24.24 198 0.001 38.1
A. sculptum 33.7 92 0.001 36.6
A. variegatum 28.95 76 0.002 36.6
R. appendiculatus 25.74 237 0.011 35
R. appendiculatus 25.18 139 0.019 34.3
Tick species OrthoMCL Reference
Search
D. andersoni Reference Bergman et al., 2000
R. appendiculatus Co-ortholog De castro et al., 2016
R. appendiculatus Co-ortholog De castro et al., 2016
R. appendiculatus Co-ortholog De castro et al., 2016
R. appendiculatus Co-ortholog De castro et al., 2016
A. variegatum In-paralog Roller et al., 2004
R. h. haemaphysaloides In-paralog Xiang et al., 2005
A. sculptum In-paralog Eliane et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
A. sculptum In-paralog Eliane et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
A. sculptum In-paralog Eliane et al., 2016
A. variegatum In-paralog Ribeiro et al., 2011
A. aureolatum In-paralog Martins et al., 2016
A. aureolatum In-paralog Martins et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
A. variegatum In-paralog Ribeiro et al., 2011
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
H. longicornis In-paralog Nakajima et al., 2008
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
A. sculptum In-paralog Eliane et al., 2016
A. variegatum In-paralog Ribeiro et al., 2011
R. appendiculatus In-paralog De castro et al., 2016
R. appendiculatus In-paralog De castro et al., 2016
(aa) Amino acid; * reference p36 protein in D. andersoni.
Table 2: Conserved motif 2 of tick p36 proteins mapped as a potential
antigenic/binding site region.
Tick species NCBI Antigenic Conserved Antigenic
accession score Motif 2 region
number location antigenic
peptide
tool/SVM
Trip tool
D. andersoni AAF03683.1 0.5880 107-127 95-128
R. appendicu-latus JAP81944.1 0.7701 117-137 108-137
R. appendicu-latus JAP88013.1 0.7379 113-133 104-133
R. appendicu-latus JAP81510.1 0.7258 102-122 94-133
R. appendicu-latus JAP86350.1 0.7072 78-98 74-110
Tick species Mapped immunogenic
segments of Motif 2
Epitopia tool
D. andersoni IDKGMLSPFNLSATVKFPLIP #
R. appendicu-latus IDNGIKTPFHLKAVFSFPITG #
R. appendicu-latus IDNGIKTPFHLKAVFSFPITG #
R. appendicu-latus IDDSMYSPFNIMTTVAFPLIG #
R. appendicu-latus IDYGIYSPFNLVTPVQFPLMG #
Tick species Mapped Binding sites of Predicted ligands
Motif 2 Sprint pep tool for Motif 2
Coach tool
D. andersoni IDKGMLSPFNLSATVKFPLIP # Lactose, Glycerol,
NAG-(4-l)GAL,
Sucrose
R. appendicu-latus IDNGIKTPFHLKAVFSFPITG # --
R. appendicu-latus IDNGIKTPFHLKAVFSFPITG # --
R. appendicu-latus IDDSMYSPFNIMTTVAFPLIG # B-Octylglucoside
R. appendicu-latus IDYGIYSPFNLVTPVQFPLMG # Alpha-D-Mannose,
Alpha- D- Lactose,
B-Octylglucoside
Bold sections: tick p36 conserved region residues mapped as
potentially antigenic/binding sites.
Bold sections: tick p36 conserved region residues mapped as
potentially antigenic/binding sites is indicated with a # sign.
Table 3: Validation of 3D structures for models 2 and 9 of D.
andersoni p36 protein.
Number Validation Parameter monitored
tool
(1) ProQPsiPred LGscore
MaxSub
(2) ProQJPred LGscore
MaxSub
Favoured region residues
(3) Rampage tool Allowed region residues
Outlier region residues
Number Limit Results
Model 2 Model 9
LG score > 1.5 fairly good model
LG score > 2.5 very good model LGscore LGscore
(1) LG score > 4 extremely good model 2.797 2.366
MaxSub > 0.1 fairly good model
MaxSub > 0.5 very good model MaxSub MaxSub
MaxSub > 0.8 extremely 0.208 0.055
good model
LG score > 1.5 fairly good model
LG score > 2.5 very good model LGscore LGscore
(2) LG score > 4 extremely good model 2.914 2.231
MaxSub > 0.1 fairly good model
MaxSub > 0.5 very good model MaxSub MaxSub
MaxSub > 0.8 extremely 0.219 0.046
good model
156 (79.2%) 152 (77.2%)
(3) 26 (13.2%) 24 (12.2%)
15 (7.6%) 21 (10.7%)
Figure 2: Multiple alignment of p36 homologous amino acid sequences
showing likely conservation region. In the case of reference D.
andersoni p36 protein, the conserved region "IDKGMLSPF" is located at
positions "107/115." (:) and (.): marks conservation between groups
of strongly or weakly similar properties, respectively. Note. Amino
acids colour according to physicochemical properties: red is for
small hydrophobic, blue for acidic, magenta for basic, and green for
hydroxyl/sulfhydryl/amine amino acid residues. Highlighted region
shows conservation in tick p36 proteins.
AAF03683.1 --HKRGHPIKATVKRLSCVPGYKLDK-PLRMS-
QDYKCESELSLFIDKGMLSPFNLSATV
JAP81944.1 -QSTIGQPVKAKVGTIRCVDNVNND-PLQNSV-
ERGTCSQSFKLSIDNGIKTPFHLKAVF
JAP88013.1 -QSTIGQPVKAKVGTIRCVDNVNND-PLQNSV-
ERGTCSQSFKLSIDNGIKTPFHLKAVF
BAD11807.1 -FTDGERPVVAAVMKPECRLKEEQE--
IVQSV-ELNDCNEIFTWNISHGIKSPFQLLVNV
JAU03129.1 -FTQGEKPIEAKVSDLKCDNVEGKN---METK-
QVIGCNETFIWEFTHGLQSPFELLVNV
ABB90890.1 -------PISVHVESLKCASTDDGD---
QVGV-RYPKCEEDLGLFITHGLQAPFDLNTTF
JAP81510.1 -QSIQGKLITASVPNLECIPHQSNKGSVQRLR-
RQSKCTEEFILFIDDSMYSPFNIMTTV
JAP87204.1 -QSIQGKLITASVPNLECIPHQSNKGSVQRLR-
RQSKCTEEFILFIDDSMYSPFNIMTTV
JAP82151.1 -QGDLGFPISTRVDKLECVPEDANRDGVQKMR-
RTSSCTEEFTLDIDRGMYIPFTLSTVV
JAP86350.1 -QGDVGLPITTSVDKLECISEDTRG---
QKMD-YKYRCTEDFMLHIDYGIYSPFNLVTPV
BAG11660.1 -IGGNRRPISTYAQAMQVGKMKVLRKPVKFSPPQ-
DLVCHLNLTWNFTRHLLSPFPTYLNL
DAA34748.1 -APNGLYPVKAKLQNVT CEPPFHDYKEMSAEV---
Q--MINYFLKLKNGIYCPFALSLNL
JAU02519.1 -LANDAVPITATVGAINFSSPPADLIPLSEDL---
QFMTVAHLFSLKKSICGPFRLPINV
DAA34145.1 -NLSGVLPLTAKLENVSFNPPLEEFSPFVTSV---
EMWAIHHLWNLTKWILCPMALPVNM
JAU02613.1 -QQDEVYPIRAHISTITCEPPVDAYDSINSDA---
GLLLITYVWNLTKQIYCPFLVSAKV
DAA34595.1 -DRPNVSPITVKVADVT CHPAPLEYERLDSNF---
GVKRIVYVWNITSRIWSPFKLNINV
JAP85564.1 -NLFGQQPISAHAGSFNCDKELLD----YSDL---
DVKLVMCLWYIPQKICSPVGIYVNV
JAT98922.1 -NMTNEHSIEAKVGKMKCADVRYFG---TGDS---
RGTMALYIWNFRQSIQSPFPLFTTV
JAU02539.1 -NKSNEHPIVANVDGMRCKSIIPDN---NRYP---
KVVMALYIWRFNHSIRSPFELPVNV
JAT98921.1 -NKSNEHPIVAKANEMKCNNIVTNR---YDYP---
KGVMALYIWHFNHSIRSPFHLFVRV
JAP85022.1 --YPEKHPVKARVVSTTYTQCQGTS---
TLNA-REGHCKGSFYWNIKRGISSSFSIKAEE
JAP86306.1 --PQQIQPVKAEVESMDYSMCFGAD---Y-QY-
EEQDCTGLFSWSVNGGITSPFSAKVEI
JAP82143.1 --SAEIPPVTAKVAWMIYGDCHPHT---
RREI-PKMNCSGHFSWAFHEGIVCPFHLQYNT
JAP88255.1 RGGVKKSPVSAEVDWINYEKCNETK---YNES-
QTKNCTGYFKWSLVAGVNSSFSIQQFT
JAP85729.1 --GATGHPVSAEVDWYGYEKCNETE---NLTR-
PAEDCMGYFKWSLSEGINGPFSFKQFT
JAP85730.1 --GATGHPVSAEVDWYGYEKCNETE---NLTR-
PAEDCMGYFKWSLSEGINGPFSFKQFT
JAP81863.1 -KRKNKHPITASVSEITYHGDCSYG----RDF-
QSKICNDFFQWYIYSSIVSPFSLLVNL
JAP81735.1 --NGESPTLTAKAGQLAFGNGCEKR----L-S-
TTKECSDLYMFYIYNGTITPFNLTIDL
JAP86032.1 ---NEWPTVKAKTGELVYGDQCKKV----
TYF-PDMDCSDYYIYYIYNGISSPFDLPINL
JAP78061.1 --LSYEHAVTSKVSPLSYGTGCEDT----SPF-
QNSKCKEMFNWQIDNGIVTPLDLLVNV
JAP86680.1 --LPSEPPVNAVVSPLIYEANCTYT----AEF-
DYSKCKDMFTWDIDYGIFSPLSLPVNV
JAP86324.1 --LKDEHPVEGKVQEFEYQNECERT----NSS-
PTSKCFDSYTFYFSKSILTPFDLKANI
JAP81446.1 --PGHERIVTASVGQVHYNGDCYHS----KRF-
DYKNCKETYVWLMLKSILTPFRLPISV
 Printer friendly
 Cite/link
 Email
 Feedback
| |
| Title Annotation: | Research Article |
|---|---|
| Author: | Oyugi, Martin Omulindi; Kinyua, Johnson Kangethe; Magiri, Esther Nkirote; Kigoni, Milcah Wagio; Cost |
| Publication: | Advances in Bioinformatics |
| Date: | Jan 1, 2018 |
| Words: | 5994 |
| Previous Article: | A Novel Framework for Ab Initio Coarse Protein Structure Prediction. |
| Next Article: | Gaussian Fuzzy Number for STR-DNA Similarity Calculation Involving Familial and Tribal Relationships. |
| Topics: | |