Printer Friendly

Identificacion molecular y actividad sobre sustratos cromogenicos de la venombina A del veneno de la serpiente peruana Bothrops atrox.

Molecular identiffcation and activity upon chromogenic substrates of a venombin A from Bothrops atrox Peruvian snake venom

Introduccion

Las serpientes del genero Bothrops habitan una extensa region de America y en el Peru se presentan hasta 17 especies, siendo el Jergon, Bothrops atrox (Linnaeus, 1758), la mas abundante, peligrosa y causante del 90% de los accidentes ofidicos en el Peru (Loja et al. 2000, Yarleque 2000). Como consecuencia de la mordedura se presenta dolor intenso en la zona afectada, edema, hemorragia y un severo descenso de la presion arterial que ocasiona la muerte; en otros casos una masiva necrosis que lleva a la amputacion del miembro afectado (Levano & Fernandez 2004).

Estudios previos del veneno de B. atrox han determinado actividades esterasica, fibrinolitica y kininogenasica, las cuales se encuentran relacionadas con la marcada accion del veneno sobre la coagulacion sanguinea (Loayza et al. 1985). Entre las enzimas relacionadas con esta accion se encuentran las similares a trombina (ESTs), las cuales de igual forma que la trombina, producen coagulos que bloquean la circulacion sanguinea aunque su mecanismo de accion sea diferente, ya que preferentemente liberan solo fibrinopeptidos A o B, mientras que la trombina produce la liberacion de ambos fibrinopeptidos de la molecula del fibrinogeno, es decir, los fibrinopeptidos A y B (Braud et al. 2000; Lu et al. 2005). Esta enzima ha sido detectada en varios venenos botropicos incluido B. atrox utilizando como sustratos plasma bovino como tambien fibrinogeno bovino y canino (Orejuela et al. 1991). En un estudio previo, Sandoval et al. (2010), lograron purificar la EST de B. atrox e identificar algunas propiedades bioquimicas como el peso molecular y el contenido de azucares, asi como su accion sobre esteres de arginina como el BAEE.

Para el estudio de las propiedades estructurales y funcionales de las enzimas presentes en los venenos de serpiente se han usado diferentes aproximaciones siendo la mas comun la obtencion de la secuencia de aminoacidos, asi como la accion enzimatica sobre sustratos naturales, las cuales tienen como desventaja el empleo de una gran cantidad de muestra para los respectivos analisis (Smolka et al. 1998). En este aspecto, el empleo alternativo de tecnicas microanaliticas como la espectrometria de masas MALDI-TOF (matriz-assistedlaser desortion/ionization - time-of-flight mass spectrometry) permiten la identificacion de proteinas a traves de la interpretacion de los espectros de fragmentacion de los peptidos generados a partir de su proteolisis (habitualmente con tripsina). Estos espectros son comparados con una base de datos de proteinas digeridas in silico y analizados con softwares especificos (ProFound, Mascot, etc.) (Ashcroft 2003). A su vez, el empleo de sustratos cromogenicos que imiten los sitios de corte de las enzimas sobre los sustratos originales permite lograr una mayor profundidad en el estudio del reconocimiento enzima-sustrato, importante en el diseno posterior de inhibidores sinteticos para estas proteinas (Castro et al. 2001).

En este contexto, en el presente trabajo se describe la identificacion molecular de la enzima similar a trombina del veneno de B. atrox mediante espectrometria de masas MALDI-TOF, asi como su actividad diferencial sobre diversos sustratos cromogenicos.

Materiales y metodos

Material Biologico.- Se utilizo el veneno de ejemplares adultos de Bothrops atrox procedentes de Pucallpa (Ucayali, Peru) y mantenidos en cautiverio en el serpentario Oswaldo Meneses del Museo de Historia Natural de la Universidad Nacional Mayor de San Marcos. El veneno fue extraido por presion manual de las glandulas venenosas, siendo luego liofilizado y conservado a 4 [grados]C hasta su utilizacion en las pruebas experimentales correspondientes.

Cuantificacion de proteinas.- La cantidad de proteina fue calculada midiendo la absorbancia de luz UV a 280 nm (Warburg & Christian 1941) en un espectrofotometro Shimadzu UV 120-02. Ademas se empleo el metodo de Lowry et al. (1951) modificado (Loayza et al. 1985) utilizando un fotocolorimetro y albumina serica bovina como proteina estandar.

Purificacion de la enzima similar a trombina.- Para la purificacion de la EST del veneno de B. atrox se empleo la metodologia segun Sandoval et al. (2010). Se utilizo 200 mg de veneno crudo disuelto en buffer acetato de amonio 0,05 M, pH 6,0; el cual fue separado mediante filtracion molecular en Sephadex G-75 (45,2 x 1,2 cm), luego por intercambio cationico en CM Sephadex C-50 (35 x 1,2 cm) y finalmente usando cromatografia de afinidad en Agarosa-PAB (6 x 0,8 cm). Para el monitoreo de la purificacion se empleo la actividad enzimatica sobre BApNA, y las fracciones con mayor actividad fueron concentradas y mantenidas en congelacion hasta su uso.

Evaluacion de la pureza y determinacion del peso molecular.- Se empleo la electroforesis en geles de poliacrilamida en condiciones denaturantes con SDS (PAGE-SDS), de acuerdo al metodo de Laemmli (1970), utilizando un equipo de electroforesis vertical en placa Mini-PROTEAN 3. La corrida electroforetica se realizo aplicando 100 V constantes durante 1 h. Luego de transcurrido el tiempo, el gel fue transferido a una solucion colorante de azul brillante de Coomassie al 0,1% por 10 min, para luego ser destenido hasta evidenciar las bandas proteicas. El peso molecular de la enzima purificada fue estimado por comparacion con una mezcla de proteinas para electroforesis en gel (Amersham Biosciences), conteniendo: fosforilasa b (97 kDa), albumina serica bovina (66 kDa), ovalbumina (45 kDa), anhidrasa carbonica (30 kDa) e inhibidor de tripsina (20,1 kDa).

Digestion in gel e identificacion molecular mediante espectrometria de masas MALDI-TOF.- Luego de realizada la electroforesis en geles de poliacrilamida, la banda correspondiente a la enzima similar a trombina fue escindida y rehidratada con acetonitrilo 50% en bicarbonato de amonio 25 mM. La proteina fue reducida con ditiotreitiol (DTT) 10 mM en bicarbonato de amonio 25 mM a 57 [grados]C durante 1 h, y S-carbamidometilada con iodoacetamida 55 mM en bicarbonato de amonio 25 mM a temperatura ambiente durante 1 h.

La digestion in gel fue llevada a cabo con tripsina 12,5 ng/ [micron]L a 37 [grados]C durante 15 h. Posteriormente, se mezclaron 0,5 [micron]L de los fragmentos peptidicos con 0,5 [micron]L de acido [alfa]-ciano-4 hidroxicinamico en acetonitrilo 50% / TFA 1% (10 mg/mL) y luego fueron aplicados a un espectrometro de masas Applied Biosystems 4700 Proteomics Analyzer, ABI, para su analisis mediante espectrometria de masas MALDI-TOF utilizando un rango de deteccion de 500 a 4500 Da. Mediante esta tecnica se realiza la ionizacion de las moleculas y su obtencion en fase gaseosa (desorcion/ionizacion asistida por matriz, MALDI), para luego ser acelerados hacia un analizador y separados en funcion de su relacion masa/carga (m/z) y determinando el tiempo de llegada a un detector (tiempo de vuelo, TOF).

[FIGURA 1 OMITIR]

[FIGURA 2 OMITIR]

[FIGURA 3 OMITIR]

Los pmfs (peptide mass fingerprints) recuperados del procedimiento anterior fueron graficados utilizando el programa Data Explorer Version 4,4 (Applied Biosystems) y analizados empleando el programa on line MASCOT (http://www.matrixscience. com) (Perkins et al. 1999) siendo contrastados contra la base de datos de secuencias de proteinas para espectrometria de masas (MSDB). Mediante este analisis, los picos correspondientes a los pmfs son combinados in silico con los de proteinas conocidas permitiendo la identificacion de la proteina digerida inicialmente.

Actividad Fibrinocoagulante.- Esta actividad se evaluo por la medida del tiempo de formacion del coagulo originado por la accion de la enzima sobre el fibrinogeno bovino (Sigma-Aldrich Chemical Co) (Devi et al. 1972). Una unidad de actividad (U) se define como la inversa del tiempo de coagulacion en segundos.

Actividad sobre Sustratos Cromogenicos.- En primer lugar se midio la actividad amidolitica empleando BApNA (Sigma Aldrich Chemical Co) como sustrato (Fig. 1), midiendose la liberacion de p-nitroanilida a 405 nm (Erlanger et al. 1961). Una unidad de actividad (U) es expresada como umoles de p-nitroanilida liberados por minuto.

Posteriormente se emplearon los siguientes sustratos: S-2238 (H-D-fenilalanil-L-pipecolil-L-arginina-p-nitroanilida, sustrato cromogenico para trombina), S-2251 (H-D-valil-leucil-lisinap-nitroanilida, sustrato cromogenico para plasmina) y S-2266 (H-D-valil-leucil-arginina-p-nitroanilida, sustrato cromogenico para kalikreina glandular) provenientes de Chromogenix (Molndal, Suecia), disueltos en buffer Tris-HCl 0,05 M; pH 7,5 conteniendo NaCl 0,15 M, a una concentracion final de 0,1 mM (Fig. 1). La hidrolisis de los sustratos sinteticos por el veneno crudo y por la enzima purificada fue medida en una lectora de microplacas Thermomax (Molecular Devices, Menlo Park, CA, USA), siguiendo la absorbancia a 405 nm a 37 [grados]C durante 20 min a intervalos de 10 segundos.

Resultados

Purificacion de la enzima y estimacion del peso molecular.- Siguiendo los pasos descritos por Sandoval et al. (2010) se pudo obtener la enzima similar a trombina de B. atrox al estado homogeneo, la cual fue monitoreada por su actividad sobre el sustrato sintetico BApNA. El ensayo electroforetico en PAGESDS mostro que la enzima purificada corresponde a una unica banda homogenea con un peso molecular aproximado de 29,6 kDa (Fig. 2).

Identificacion de la enzima purificada mediante espectrometria de masas MALDI-TOF.- Del analisis por espectrometria de masas MALDI-TOF, se pudieron recuperar 16 fragmentos peptidicos producto de la digestion de la enzima purificada, con valores de masas comprendidos entre los 500 y 4500 Da (Tabla 1). Estos valores obtenidos fueron utilizados para la identificacion de la proteina mediante el programa MASCOT (opcion: peptide mass fingerprinting). Como resultado del analisis in silico se obtuvo un score de alineamiento de 125 (expect: 10-6) con la proteina denominada venombina A (EC 3.4.21.74) (Fig. 3). Los peptidos recuperados comprenden un 75% del total de su secuencia.

Actividad sobre diferentes sustratos.- La EST purificada fue capaz de coagular el fibrinogeno bovino; comparando los tiempos de coagulacion obtenidos con el veneno crudo y la enzima purificada se encontraron actividades especificas de 1,26 y 5,50 U/mg respectivamente, siendo la actividad de la enzima purificada 4,37 veces mas que la actividad del veneno crudo (Tabla 2).

La enzima purificada tambien mostro una gran capacidad para hidrolizar sustratos sinteticos como el BApNA (0,874 U/mg), siendo la actividad purificada 25,5 veces respecto a la actividad mostrada por el veneno crudo (Tabla 2).

En el caso de las actividades sobre otros sustratos sinteticos especificos estas fueron de 8,7 y 22,7 U/mg sobre S-2238 para el veneno crudo y la enzima purificada respectivamente, y de 7,8 y 23,4 U/mg sobre S-2266 para el veneno crudo y la enzima purificada respectivamente. No se encontro actividad sobre S-2251 bajo las mismas condiciones de trabajo tanto para el veneno crudo como para la enzima purificada (Tabla 2).

Discusion

Los venenos de serpientes de la familia Viperidae, presentan cantidades significativas de enzimas similares a trombina, las cuales son serinoproteasas y son similares a la trombina tanto en sus propiedades fisicoquimicas como en los aminoacidos de su sitio activo, ya que contienen residuos reactivos de serina, acido aspartico e histidina, haciendolos susceptibles a agentes especificos que modifican su accion enzimatica (Braud et al. 2000).

En el presente trabajo la purificacion de la enzima similar a trombina (EST) del veneno de B. atrox consistio de una combinacion de tecnicas cromatograficas de filtracion molecular, las que permiten separar las moleculas segun su peso molecular; intercambio ionico, donde las moleculas son discriminadas de acuerdo a su carga electrica; y finalmente mediante afinidad enzima-inhibidor, utilizando p-aminobenzamidina (PAB). Esta molecula es un inhibidor competitivo especifico de serinoproteasas, mediante la cual se pueden retener a las fracciones con afinidad permitiendo la eliminacion de contaminantes. Del analisis electroforetico de las fracciones obtenidas se observo una sola banda proteica de 29,6 kDa, indicando la homogeneidad del preparado (Fig. 2). Esta enzima tiene un mediano peso molecular, pero se encuentra dentro del rango de pesos moleculares reportados para varias enzimas similares a trombina aisladas de venenos de serpiente (Sandoval et al. 2010).

Para la identificacion molecular de la enzima purificada se empleo el analisis por espectrometria de masas MALDI-TOF; que permite obtener informacion de la masa molecular e informacion estructural del compuesto analizado.

Del analisis por espectrometria de masas de las bandas de gel correspondientes a la EST de B. atrox y la posterior busqueda en bases de datos, se obtuvo un score de alineamiento de 125 (expect: 10-6) con la venombina A (EC 3.4.21.74), EST del veneno de B. moojeni (Fig. 3). Esta proteina, a diferencia de la trombina, convierte el fibrinogeno en fibrina liberando solo el fibrinopeptido A (Itoh et al. 1988). Esta caracteristica le confiere un efecto defibrinogenante permitiendo que la fibrina sea rapidamente degradada a traves del proceso fibrinolitico y eliminado mediante la orina (Lu et al. 2005). Actualmente es usado en el campo clinico para el tratamiento de enfermedades tromboticas .

Este analisis nos permitio ademas, ubicar y alinear los fragmentos producto de la digestion de la enzima en estudio. Los fragmentos recuperados cubrieron un 75% de la secuencia de la venombina A indicando una alta homologia entre las secuencias de ambas proteinas. La venombina A es la enzima similar a trombina del veneno de B. moojeni y su secuencia de aminoacidos exhibe una homologia significativa con enzimas proteoliticas como la tripsina, la kalikreina pancreatica y la trombina, lo cual indica que se trata de un miembro de la familia de las serinoproteasas (Itoh et al. 1998).

A fin de complementar los resultados estructurales obtenidos por espectrometria de masas MALDI-TOF, se evaluo la actividad enzimatica de la EST purificada sobre un sustrato natural como el fibrinogeno, asi como sobre sustratos cromogenicos, los cuales contienen residuos de aminoacidos que imitan los sitios de corte de la enzima sobre el sustrato original. A fin de facilitar la medicion de la actividad, dichos sustratos presentan un grupo cromogenico en el extremo carboxilo terminal, el cual es liberado como parte de la hidrolisis y posteriormente detectado por espectrofotometria.

En el presente trabajo se evaluo la actividad enzimatica de la EST de B. atrox sobre diversos sustratos sinteticos que contienen como grupo cromogenico a la p-nitroanilida (Fig. 1). Durante los diversos pasos de purificacion se empleo el sustrato BApNA el cual permite la caracterizacion de enzimas del grupo de las serinoproteasas como la tripsina y quimiotripsina y al cual pertenecen las enzimas similares a trombina de venenos de serpiente (Castro et al. 2001, 2004). Las fracciones que mostraron mas actividad sobre este sustrato fueron ensayadas en su capacidad para coagular el fibrinogeno bovino obteniendose resultados positivos indicando que ambas actividades estan presentes en la enzima en estudio. En el caso de los sustratos sinteticos S-2266, S-2238 y S-2251, su empleo nos permitio determinar la especificidad en reconocimiento de los aminoacidos unidos al grupo cromogenico p-nitroanilida por parte de la enzima similar a trombina de B. atrox. Como se muestra en la Tabla 2, la enzima fue capaz de hidrolizar los sustratos S-2266 (sustrato para kalikreina glandular) y S-2238 (sustrato para trombina), mientras que fue incapaz de hidrolizar el sustrato S-2251 (sustrato para plasmina). En base a las caracteristicas estructurales de estos sustratos podemos afirmar que la enzima presenta una especificidad para hidrolizar sustratos que contengan preferentemente arginina como el aminoacido que se une al grupo cromogenico a diferencia de la lisina la cual se encuentra en la estructura del S-2251, lo cual constituye una evidencia adicional de que esta enzima pertenece al grupo de las serinoproteinasas. Este analisis tambien fue realizado utilizando la enzima similar a trombina de Lachesis muta muta empleando sustratos cromogenicos con aminoacidos diversos en su estructura (Magalhaes et al. 2003). El hecho de que la enzima purificada hidrolice sustratos especificos para dos enzimas diferentes como la kalikreina y la trombina indican por un lado que nuestra enzima presenta caracteristicas de la trombina como la de coagular el fibrinogeno, mientras que por otro esta relacionada con las enzimas del grupo tripsina/kalikreina. Esto fue demostrado por Itoh et al. (1988) para el caso de batroxobina, la enzima similar a trombina de la serpiente B. moojeni mediante el analisis de la secuencia nucleotidica del gen.

De esta forma, mediante una combinacion de aproximaciones estructurales y funcionales se ha podido caracterizar la naturaleza quimica y enzimatica de la EST de B. atrox, identificandola como una venombina A, serinoproteasa con un rol importante en el envenenamiento por viperidos del genero Bothrops y cuya deteccion y neutralizacion resultan de interes para el diagnostico y tratamiento de accidentes ofidicos.

Agradecimientos

El presente trabajo fue desarrollado gracias al financiamiento otorgado a Gustavo Sandoval por la Red de Macrouniversidades de America Latina y el Caribe a traves de una beca de investigacion en la Universidad Federal de Rio de Janeiro como parte del desarrollo de su tesis de maestria en Biologia Molecular.

Literatura citada

Ashcroft A.E. 2003. Protein and peptide identification: the role of mass spectrometry in proteomics. Nat. Prod. Rep. 20(2):202-215.

Braud S., C. Bon C & A. Wisner. 2000. Snake venom proteins acting on hemostasis. Biochimie. 82(9-10):851-859.

Castro H.C., D.M. Silva, C. Craik C, et al. 2001. Structural features of a snake venom thrombin-like enzyme: thrombin and trypsin on a single catalytic platform? Biochim Biophys Acta. 1547(2):183-195.

Castro H.C., R.B. Zingali, M.G. Albuquerque, et al. 2004. Snake venom thrombin-like enzymes: from reptilase to now. Cell Mol Life Sci. 61(7-8):843-856.

Devi A., S. Banerjee & A.L. Copley. 1972. Coagulant and esterase activities of thrombin and Bothrops atrox venom. Toxicon. 10(6):563-573.

Erlanger B.F., N. Kokowsky & W. Cohen. 1961. The preparation and properties of two new chromogenic substrates of trypsin. Arch Biochem Biophys. 95:271-278.

Itoh N., N. Tanaka, I. Funakoshi, et al. 1988. Organization of the gene for batroxobin, a thrombin-like snake venom enzyme. Homology with the trypsin/kallikrein gene family. J Biol Chem. 263(16):7628-7631.

Laemmli UK. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature. 227(5259):680-685.

Levano J. & R. Fernandez. 2004. Diagnostico y tratamiento de los accidentes por animales ponzonosos. Instituto Nacional de Salud, Ministerio de Salud, Lima, Peru. 1era edicion. 74 Pp.

Loayza S., Y. Morante, S. Campos, et al. 1985. Enzimas proteoliticas en el veneno de las serpientes peruanas Lachesis muta y Bothrops atrox. Bol Soc Quim Peru. 52(3):151-163.

Loja D., R. Aviles, Y. Necochea, et al. 2000. Ofidismo por Bothrops atrox: Estudio clinico-epidemiologico. Diagnostico. 38(5):261-265.

Lowry O.H., N.J. Rosebrough, A.L. Farr, et al. 1951. Protein measurement with the Folin phenol reagent. J Biol Chem. 193(1):265-275.

Lu Q., J.M. Clemetson & K.J. Clemetson. 2005. Snake venoms and hemostasis. J Thromb Haemost. 3 (8):1791-1799.

Magalhaes A., R.N. Ferreira, M. Richardson, et al. 2003. Coagulant thrombin-like enzymes from the venoms of Brazilian and Peruvian bushmaster (Lachesis muta muta) snakes. Comp Biochem Physiol B Biochem Mol Biol. 136(2):255-266.

Orejuela P., A. Zavaleta, M. Salas, et al. 1991. Thrombin-like activity in snake venoms from Peruvian Bothrops and Lachesis genera. Toxicon. 29(2):1151-1154.

Perkins D.N., D.J. Pappin, D.M. Creasy, et al. 1999. Probability-based protein identification by searching sequence databases using mass spectrometry data. Electrophoresis. 20(18):3551-3567.

Sandoval G., L. Lerma, E. Rodriguez, et al. 2006. Purification of polyclonal antibodies against Bothrops atrox Peruvian snake venom ("Jergon") by affinity chromatography. Rev Soc Quim Peru. 72(3):140-149.

Sandoval G.A., N. Ruiz, F. Lazo, et al. 2010. Isolation and partial characterization of a thrombin-like enzyme from Bothrops atrox Peruvian snake venom "Jergon". Rev Soc Quim Peru. 76(2):156-164.

Smolka M.B., S. Marangoni, B. Oliveira, et al. 1988. Purification and partial characterization of a thrombin-like enzyme, balterobin, from the venom of Bothrops alternatus. Toxicon. 36(7):1059-1063.

Warburg O. & W. Christian. 1941. Isolierung and Kristallisation der Garungs ferments enolase. Biochem Z. 310: 384-421.

Yarleque A. 2000. Las serpientes peruanas y sus venenos. Fondo Editorial, Universidad Nacional Mayor de San Marcos. Lima-Peru. 78 Pp.

Gustavo A. Sandoval (1), Fanny Lazo (1), Edith Rodriguez (1), Armando Yarleque (1) * y Russolina B. Zingali (2)

* corresponding author

(1) Laboratorio de Biologia Molecular, Facultad de Ciencias Biologicas, Universidad Nacional Mayor de San Marcos. Ciudad Universitaria, Av. Venezuela Cdra. 34 s/n. Apartado 110058, Lima 11, Peru. Email Armando Yarleque: ayarleque48@gmail.com

(2) Laboratorio de Hemostasia y Venenos. Departamento de Bioquimica Medica. Universidad Federal de Rio de Janeiro. Rio de Janeiro -- Brazil.

Presentado: 01/11/2009

Aceptado: 15/12/2010

Publicado online: 21/01/2011
Tabla 1. Masas teoricas y experimentales de los peptidos de la
EST de Bothrops atrox obtenidas por espectrometria de masas
MALDI-TOF. La masa experimental fue calculada en base a la masa
de los peptidos monoisotopicos, asumiendo su valor como
[[M+H].sup.+]

                                                               Masa
                                                             teorica
Secuencia                                         Posicion     (Da)

R.YFCGMTLINQEWVLTAAHCNR.R                          48-68     2583,1821
R.IHLGK.H                                          73-77     566,3540
K.HAGSVANYDEVVR.Y                                  78-90     1415,6793
K.FICPNK.K                                         96-101    777,3843
K.NVITDK.D                                        104-109    688,3755
K.DIMLIR.L                                        110-115    759,4313
K.DIMLIR.L Oxidation (M)                          110-115    775,4262
R.LDRPVK.N                                        116-121    726,4388
K.NSEHIAPLSLPSNPPSVGSVCR.I                        122-143    2317,1485
R.IMGWGAITTSEDTYPDVPHCANINLFNNTVCR.E              144-175    3665,6701
R.EAYNGLPAK.T                                     176-184    961,4869
K.TLCAGVLQGGIDTCGGDSGGPLICNGQFQGILSWGSDPCAEPR.K   185-227    477,0196
R.KPAFYTK.V                                       228-234    853,4698
K.VFDYLPWIQSIIAGNK.T                              235-250    1862,9931

                                                          Masa
Secuencia                                          experimental (Da)

R.YFCGMTLINQEWVLTAAHCNR.R                              2584,1893
R.IHLGK.H                                               567,3613
K.HAGSVANYDEVVR.Y                                      1416,6866
K.FICPNK.K                                              778,3916
K.NVITDK.D                                              689,3828
K.DIMLIR.L                                              760,4385
K.DIMLIR.L Oxidation (M)                                776,4335
R.LDRPVK.N                                              727,4461
K.NSEHIAPLSLPSNPPSVGSVCR.I                             2318,1557
R.IMGWGAITTSEDTYPDVPHCANINLFNNTVCR.E                   3666,6773
R.EAYNGLPAK.T                                           962,4941
K.TLCAGVLQGGIDTCGGDSGGPLICNGQFQGILSWGSDPCAEPR.K        4478,0267
R.KPAFYTK.V                                             854,4470
K.VFDYLPWIQSIIAGNK.T                                   1864,0003

Tabla 2. Actividad del veneno crudo y de la EST de Bothrops atrox
sobre diferentes sustratos.

                              Actividad Especifica
                                (U/mg proteina)
Sustrato              pH                             Incremento de
                             Veneno crudo   Enzima    la actividad

Fibrinogeno bovino    7,4        1,26        5,50         4,4
BApNA                 8,1       0,034       0,874         25,5
S-2266                7,5        7,8         23,4         3,0
S-2238                7,5        8,7         22,7         2,6
S-2251                7,5        0,0         0,0          0,0
COPYRIGHT 2010 Universidad Nacional Mayor de San Marcos
No portion of this article can be reproduced without the express written permission from the copyright holder.
Copyright 2010 Gale, Cengage Learning. All rights reserved.

Article Details
Printer friendly Cite/link Email Feedback
Author:Sandoval, Gustavo A.; Lazo, Fanny; Rodriguez, Edith; Yarleque, Armando; Zingali, Russolina B.
Publication:Revista peruana de biologia
Article Type:Report
Date:Dec 1, 2010
Words:3936
Previous Article:Prevalencia y distribucion de los principales agentes etiologicos que afectan los langostinos silvestres en Tumbes, Peru.
Next Article:Toxicidad aguda y cronica del lindano sobre Ceriodaphnia comuta (Cladocera: Daphniidae).
Topics:

Terms of use | Privacy policy | Copyright © 2022 Farlex, Inc. | Feedback | For webmasters |