Printer Friendly

Analisis de las polihidroxialcanoato sintasas (PhaC1 y PhaC2) en una cepa de Pseudomonas fluorescens IBUN S1602, aislada en suelos colombianos.

Analysis of polyhydroxyalkanoate synthases (PhaC1 and PhaC2) in a strain of Pseudomonas fluorescens IBUN S1602 isolated from Colombian soil

Introduccion

Los biopolimeros de tipo polihidroxialcanoato (PHAs) son una alternativa a los polimeros de origen petroquimico (derivados del petroleo). Tienen aplicaciones en los sectores domestico, industrial, medico y de construccion, convirtiendose en un material imprescindible en la epoca actual (Dobroth et al., 2011; Posada et al., 2011; Anderson y Dawes, 1990), con la ventaja de ser biodegradados a dioxido de carbono y agua en condiciones aerobias, a los pocos meses de uso (Boskhomdzhiev et al., 2010; Braunegg et al., 1998; Weng et al., 2011;).

Las especies pertenecientes al genero Pseudomonas acumulan PHAs de cadena media (6-14 carbonos) que presentan propiedades elastomericas de interes en aplicaciones medicas especialmente (Chardron et al., 2010; Marchessault et al., 2011; Rai et al., 2011). Se caracterizan por contener dos genes diferentes, phaC1 y phaC2, que codifican una clase de sintasa tipo II (De Eugenio et al., 2010; Slawomir et al., 2011). Para la produccion del biopolimero solo se necesita la expresion de uno de los genes (Rehm, 2007).

El cluster en la produccion de PHAs de cadena media posee seis genes de los cuales dos genes phaC (phaC1 y phaC2) codifican PHA sintasas de clase II y estan separados por el gen phaZ que codifica para un PHA depolimerasa intracelular (De Eugenio et al., 2007). Ademas, corriente abajo de estos genes esta localizado el gen phaD (codifica para una proteina estructural que estabiliza los granulos PHA) seguido por los genes phaI y phaF que se transcriben en direccion opuesta al resto de los genes y codifican proteinas estructurales y reguladoras (Arias et al., 2008; Olivera et al., 2010; Rehm, 2003; Sandoval et al., 2007).

La enzima PhaC sintasa es indispensable en la biosintesis de PHA. Su funcion es tomar las unidades R-3 hidroxiacil-CoA y formar el polimero (Olivera et al., 2001; Rehm, 2007; Rehm, 2006; Stubbey Tian, 2003). La sintasa se divide en cuatro clases segun su afinidad por sustratos de diferentes atomos de carbono. La clase II tiene afinidad por sustratos con cinco carbonos o mas unidades en su estructura. Las sintasas presentan las principales caracteristicas de la super familia a/p hidrolasa: la triada catalitica posee en el sitio activo una serina, cisteina o aspartato; presenta un aminoacido acidico entre asparto o glutamato e incluye histidina (Wahab et al., 2006; Rehm, 2003).

Rehm, en 2007, explica que en la comparacion de los alineamientos de 88 genes de sintasas provenientes de 68 bacterias diferentes se encuentra la presencia de 6 bloques conservados de acuerdo con la similaridad de los aminoacidos. De otro lado, la region N-terminal es altamente variable. Se destaca la identificacion de 8 residuos de aminoacidos identicos y presentes en todas las sintasas que se compararon.

En la actualidad, la principal limitante para la produccion de los PHAs, a nivel comercial, radica en el costo del producto final frente a los plasticos petroquimicos. El uso de organismos geneticamente modificados hace parte de las principales estrategias que utilizan las empresas de mayor trascendencia en el mercado de los PHAs y es tema de estudio de los principales grupos de investigacion (Garcia et al., 2004; Choi et al., 1998; Hein et al., 1997). El conocimiento de los genes de sintesis y enzimas asociadas a la estabilizacion del granulo de PHAs es imprescindible para llevar a cabo la manipulacion genetica de las celulas de interes..

Por ello el objetivo del presente trabajo se centro en la determinacion de la organizacion de los genes phaC1 y phaC2 en la cepa nativa Pseudomonas fluorecens IBUN S1602, escogida como promisoria por la capacidad que poseen sus enzimas sintasas de utilizar sustratos economicos como el glicerol, aceites usados, suero de leche , entre otros, a la vez se realizo el analisis a nivel de estructura primaria y secundaria de la enzima sintasa, para de esta manera poder contribuir con el entendimiento basico de la biosintesis de PHA en esta cepa, que permitira el aumento de la calidad de PHA debida a la modulacion del nivel de sintasa que se exprese en un organismo recombinante, con el fin de variar el peso molecular del biopolimero, propiedad esencial en el estudio de aplicaciones industriales.

Materiales y metodos

Microorganismos y condiciones de crecimiento

Se emplearon dos cepas de Pseudomonas como control positivo: Pseudomonas fluorecens IBUN 066 y Pseudomonas aeruginosa ATCC 1040. La cepa Clostridium sp IBUN 13A se tomo como control negativo. La cepa IBUN S1602 proviene de cultivos de cana de azucar colombiana, en la region de Norte de Santander, y se mantiene por criopreservacion. Todos los aislamientos empleados fueron proporcionados por el Instituto de Biotecnologia de la Universidad Nacional de Colombia. En estudios previos del grupo de investigacion (Moreno et al., 2004 y 2007;). Se verifico la acumulacion de polihidroxialcanoato por tincion con sudan negro, prueba de hipoclorito y gravimetria. Las cepas se activaron en caldo nutritivo de 12 a 24 horas a 30[grados]C, se sembro por agotamiento en agar nutritivo de 12 a 24 horas a 30[grados]C. Se verificaron las caracteristicas morfologicas por medio de tincion de Gram, y la acumulacion de PHA se comprobo mediante el crecimiento en un medio minimo de sales minerales (MSM) ajustado a pH 7,0 (Ramsay et al., 1990).

Identificacion de la cepa IBUN S1602

Se utilizaron dos metodologias para la identificacion: a) por sus propiedades bioquimicas y b) mediante la amplificacion del gen que codifica para ADN ribosomal 16s. Para la caracterizacion bioquimica se utilizo la coloracion de Gram, la siembra en agares selectivos y diferenciales (Mac-Conkey, Cetrimide, KingB) y la prueba de oxidasa. La amplificacion del gen ribosomal 16s RNA se realizo a partir de 20 ng de ADN, bajo las siguientes condiciones de la reaccion en cadena de la polimerasa, PCR: un ciclo de 10 min a 94[grados]C, 2 min a 59[grados]C y 2 min a 72[grados]C; 30 ciclos de 1 min a 95[grados]C, 1 min a 56[grados]C y 1 min 30 seg a 72[grados]C, y un ciclo de extension final de 5 min a 72[grados]C. Cada 25 pl de reaccion contenian: Buffer 1X, dNTPs 0,8 mM, 0,4 pM de cada iniciador, MgCh 1,5 mM y 0,05 U/[micron]l de Taq ADN Polimerasa. Los iniciadores que se emplearon fueron: iniciador sentido 5'GATCATGGCTCAGATTGAACG3', iniciador antisentido 5'GTTCCCCTACGGCTACCTTG 3' (Uribe, 2009). La secuencia parcial del gen 16S ARNr fue ensamblada por el programa Cap3, se utilizo ClustalW2 para realizar un alineamiento multiple con secuencias de referencias obtenidas a partir de la base de datos del Genbank, y a partir de dicho alineamiento se elaboro un dendrograma con el programa MEGA 4.0 utilizando el metodo de agrupamiento Neighborg Joning con 500 repeticiones- bootstrap.

Construccion de iniciadores

Para los genes phaC1 y phaC2 se recupero 21 secuencias de dos bases de datos para nucleotidos: servidor Entrez en NCBI (http://www.ncbi.nlm.nih.gov/Entrez) y el portal de busqueda de European Bioinformatics Institute, EBI a traves del Sistema de Recuperacion de Secuencias, SRS (http://srs.ebi.ac.uk). Los numeros de acceso al Genbank de los microorganismos que se incluyeron en el diseno son: Pseudomonas chlororaphis subs aure faciens (AB049413), Pseudomonas putida (AF150670.2), Pseudomonas aeruginosa LESB58 (NC_011770), Pseudomonas aeruginosa PAO1 (NC_002516.2), Pseudomonas entomophila L48 (NC_008027), Pseudomonas aeruginosa PA7 (NC_009656), Pseudomonassp GI-3 (AB014758), Pseudomonas corrugata CFBP5454 (AY910767), Pseudomonas mediterranea CFBP5447 (AY910768.1), Pseudomonas sp USM4-55 (EU275728), Pseudomonas pseudoalcaligenes 45L (AY043314.1), Pseudomonas putida KT2440 (AY113181), Pseudomonas putida KTCC1639 (AY286491.1), Burkholderia caryophylli (AF394660), Pseudomonas stutzeri 1317 (AY278219.1), Pseudomonas corrugata (EF067339.1), Pseudomonas resinovorans (AF129396.2), Pseudomonas nitroreducens 0802 (AF336849), Pseudomonas putida CA-3 (AY714618.1), Pseudomonas sp KBOS17 (AY790329), Pseudomonas fluorecens (FJ472656.1).

Las secuencias de nucleotidos se alinearon con el programa de licencia libre CLUSTALW2 dispuesto en la pagina web de EBI (http://www.ebi.ac.uk/Tools/clustalw2). Se identificaron los bloques conservados y se disenaron de forma manual los iniciadores para cada gen, de acuerdo con criterios establecidos. Se realizo un analisis de similitud con las bases de datos de GenBank, usando el algoritmo BLASTN (http://blast.ncbi. nlm.nih.gov/Blast.cgi) y la opcion de MEGABLAST con el fin de observar la especificidad y su sitio de union en el gen. Las propiedades de los iniciadores se obtuvieron mediante el programa CLC Main Work bench 5.1 (http://www.clcbio.com).

Deteccion y amplificacion de los genes phaC1 y phaC2 en el aislamiento IBUN S1602 mediante reaccion en cadena de la polimerasa (PCR)

La extraccion y cuantificacion de ADN se realizo con uso de solventes organicos y lavados con CTAB segun los protocolos de Sambrook et al. (1989). Se cuantifico por fluorometria en kit Quant IT[TM] (Invitrogen).

Se optimizo la PCR con un volumen total de 25 ml y se estandarizo con diferentes concentraciones de los reactivos, hasta obtener un unico fragmento de ADN de la intensidad y tamano esperado: 0,05 U/ml Taq ADN Polimerasa (Fermentas); buffer1X (Fermentas) complementado con 20 mM de sulfato de amonio; 0,2 mM de dNTPs; 3% de DMSO; iniciadores 0,7 pM; MgCl2 a 1,5 mM; ADN molde a 50 ng y 25 ng para el fragmento (JY2s/JY3a). El protocolo general de amplificacion se realizo en un equipo Labnet- Multigene: 1 ciclo inicial a 94[grados]C por 10 min, 61,8[grados]C por 2 min, y 72[grados]C por 2 min, 30 ciclos a 94[grados]C por 1 min, 58,8[grados]C por 1 min, y 72[grados]C por 1,5 min y 1 ciclo final a 72[grados]C por 5 min.

Visualizacion de los productos de PCR

Los amplimeros de PCR fueron separados por electroforesis convencional en geles de agarosa 1,5% (w/v) con TBE 0.5X y comparados con marcadores de tamano conocido de la serie Hyperladder (Bioline): II (50-200 pb), III (500-5000 pb). Se uso SYBR[R] Safe (Invitrogen) para visualizar los fragmentos de ADN. Los geles se digitalizaron en el equipo Gel Doc[R] con software Quantity One(r) (Biorad). La secuenciacion se realizo en las dos hebras de ADN a traves de la empresa Macrogen (Corea). Todos los fragmentos se secuenciaron por duplicado y se hizo un sobrelapamiento de secuencias resultantes de acuerdo con los iniciadores utilizadores.

Analisis de secuencias

Se utilizaron los programas BIOEDIT (http://www. mbio.ncsu.edu/BioEdit/bioedit.html) y CAP3 (http:// pbil.univ-lyon1.fr/cap3.php) en el ensamblaje de secuencias. Se realizo depuracion de forma manual a partir de alineamientos multiples sucesivos con el programa CLUSTALW2 (http://www.ebi.ac.uk/Tools/ Clustalw2/index.html).

Se busco marcos abiertos de lectura (ORF) de acuerdo con la aplicacion NCBI/ORF FINDER (http://www.ncbi. nlm.nih.gov/projects/gorf/). Las secuencias traducidas de cada ORF resultante se compararon con las secuencias que se reportan en las bases de datos mediante BLASTP (http://blast.ncbi.nlm.nih.gov/Blast.cgi). Se realizo alineamiento multiple CLUSTALW2 con secuencias curadas de los siguientes microorganismos: Pseudomonas chlororaphis subs aurefaciens (AB049413), Pseudomonas putida (AF150670.2), Pseudomonas aeruginosa LESB58 (NC_011770), Pseudomonas aeruginosa PAO1 (NC_002516.2), Pseudomonas entomophila L48 (NC_008027), Pseudomonas fluorescens Pf0-1 (NC_007492.2). Se identifico motivos o perfiles estrictamente conservados en las secuencias traducidas a proteinas (PhaC1 y PhaC2).

Las distancias filogeneticas de las secuencias obtenidas con respecto a las familias de proteinas que se reportan en las bases de datos y la funcion de dicha familia se determino mediante PSI- BLAST (http://www. ebi.ac.uk/Tools/psiblast/). Se busco dominios proteicos con la ayuda de CDD (Conserved Domains Database) a traves de la aplicacion RPS-BLAST (http://www. ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi). Se realizo la prediccion de las estructuras secundarias con el programa PSIPRED (http://bioinf.cs.ucl.ac.uk/psipred). Todas las herramientas bioinformaticas que se utilizaron, se desarrollaron con los parametros predeterminados.

Resultados y discusion

Una vez cultivada la cepa IBUN S1602 en caldo nutritivo, se observaron las caracteristicas morfologicas (bacilos Gram negativos); en agar Mc-Conkey se observaron colonias no fermentadoras, la prueba de oxidasa fue negativa. Se observo crecimiento en el agar cetrimide (colonias redondas verdosas regulares) y en el agar King B, que estimula la produccion de fluoresceina, se observo crecimiento y una clara fluorescencia a las 48 horas de incubacion a 30[grados]C lo cual es tipico del genero Pseudomonas, especie fluorecens, por lo que se concluyo que bioquimicamente la cepa IBUN S1602 corresponde a Pseudomonas fluorecens, siendo consistente con los resultados preliminares de pruebas bioquimicas. Posteriormente, para la caracterizacion molecular se amplifico una secuencia aproximada de 1500 pb, se realizo un Dendrograma de similitud construido por el metodo de agrupamiento de Neigbour Joining con las secuencias seleccionadas anteriormente (figura 1). Las secuencias se ubicaron en tres clusters, un primer cluster corresponde a las bacterias del genero Pseudomonas: P. aeruginosa, P. chlororaphis, P. fulva, P. stutzeri y P. aurantiaca a excepcion de P. putida y P. fluorencens que se ubicaron externas a este grupo. En el primer cluster se agruparon las especies del genero Burkholderia que se relacionan estrechamente con Pseudomonas.

[FIGURA 1 OMITIR]

En un estudio realizado por Revelo en el 2007, el aislado S1602 fue considerado como perteneciente al genero Burkholderia, sin embargo en el mismo se recomienda comprobar dicho resultado. En el presente estudio se comprobo tanto bioquimica como molecular mente que el aislado S1602 corresponde a una cepa Pseudomonas fluorecens.

[FIGURA 2 OMITIR]

De acuerdo con la revision del gen sintasa tipo II en las bases de datos, se identifico que Pseudomonas presenta una organizacion del tipo phaC1ZC2DFI. En la figura 2 se observa la ubicacion de los iniciadores que se utilizaron en el presente trabajo: JY2s (5'GGACAAYGGAGCGTYGTAGATGAGT3') y JY3a (5'TGGCRCCKATGCCGTTGAAGATC3'); JY1s (5'GACTCSTGGTGGYTGCACTGGCAG3') y JY4a (5'GGCTTGTACTGGATCAGCTCCARCA3'); JY4s (5'TGYTGGAGCTGATCCAGTACAAGCC3') y JY6a (5'ACGATMAGGTGCAGGAACAGCCAGT3').

Debido a la estandarizacion del proceso en la amplificacion de los genes, a traves de PCR se modifico el protocolo propuesto con los siguientes cambios: Mg[Cl.sub.2] a 2.0mM (JY4s/ JY6a). La temperatura de anillamiento de la segunda etapa se incremento a 60[grados]C (JY4s/JY6a) y a 61[grados]C (JY1s/JY4a).

Ensamblaje de secuencias y analisis bioinformatico

Se obtuvo el siguiente resultado del ensamblaje de las secuencias y la transcripcion de las mismas.

* IBUN S1602 PhaC1

MSNKSNDECPYQASETTLGLNPVVGLRGKDLLASARMVVTHAITQRIHSVKQITLFGIDLKNVLFGKSKLQ PAGDD-RRFVDPAWSQNPLYKRYLQTYLAWRKELHAWIDDSSLSPKDIARGHFVINLMTEAMAPTNTAANPAAV KRFFETGGKSLLD-GLSHLAKDLVHNGGMPSQVNMGAFEVGKTLGVSEGS VVFRNDVLELIQYKPITEQVHERPLLVVPPQINKFYVFDLSPDKSLARFCLRNNVQTFIVSWRNPTKEQREWGL STYIEA-LKEAVDVVTAITGSKDVNMLGACSGGITCTALLGHYAATGENKVNALTLLVSVLDTTLDSDVALFFD EQTLEMTKRHS-YQAGVLEGKDMAKVFTWMRPNDLIWNYWVNTYLLGNEPPVFDILFWNKDTTRAPAMFHGDLI EMFKNKPLTLP-DALEECGTPINLKKGSPEIFSLADATDHTSPWKSCYKSAQPFCGKVEFLLSSTGHIQSILNP PGNPKSRDTTSEEKTAKIDD-WQKKSTKHADSWRLPWQAWQGERSGELKKAPRKLGSTGYLAGESSPGALVHA R

* IBUN S1602 PhaC2

MRDKPATGVVPSPAVFINAQSAMTGLRGRDLISTLRSVAAHGLRNPIHSAKHALKLGGALGRVLLGETLHPTNP NDSR-FADPAWSLNPFYRRSLQAYLSWQKQVKSWIDESSMSDDDRARAHFAFSLINDAVAPSNTLLNPLAIKELFNS GGHSLVR-GLSHLFDDLLHNDGLPRQVTKQAFEVGKTVATTTGSVVFRNELLELIQYKPMSEKQYSKPLLVVPPQIN KYYIFDLSPSNS-FVQFALKNGLQTFMISWRNPDVRHREWGLSTYVEAVEEAMNICRAITGAREVNLMGACAGGLTI AALQGHLQAKRQLRR-VSSATYLVSLLDSQIDSPATLFADEQTLEAAKRRSYQKGVLDGRDMAKVFAWMRPNDLIWS YFVNNYLLGKEPPAF-DILYWNNDSTRLPAAFHGDLLDFFKHNPLIHPGGLEVCGTPIDLQKVTVDSFSVAGMNDHI TPWDAVYRSTL-LLGGERRFVLSNSGHVQSILNPPSNPKATYVENGKLSSDPRAWYYDAKKVDGSWWPQWLEWVQQR SGTLRETQ-MALGNANYPPMEAAPGTYVRVR

Analisis de la estructura primaria para los genes phaC1 y phaC2

El gen phaC1 tiene 1680 pb con una secuencia deducida de 559 aminoacidos y el gen phaC2 presenta 1683 pb con 560 aminoacidos. El analisis de BLASTP comprobo que la proteina PhaC1 y PhaC2 de la cepa Pseudomonas fluorecens IBUN S1602 presentan un alto grado de similaridad con las reportadas en las bases de datos para sintasa. El 50% de las coincidencias correspondieron a la proteina sintasa I y II respectivamente, principalmente del genero Pseudomonas (48/50). Se observo un porcentaje de identidad de 70 a 88 % para PhaC1 y de 71 a 96% para PhaC2, con un E-value de 0,0 y de 100% de area de cubrimiento de secuencia para PhaC1 en todos los registros y 97% para PhaC2 en 2 coincidencias y 100% en el restante.

En el alineamiento que se realizo de la secuencia de PhaC1 , se observo que la proteina de cepa IBUN S1602 presenta los 8 residuos estrictamente conservados (S229; C287; G290; D319; W388; D442; G469; H470) que reporta la literatura (Rehm, 1993; Rehm, 2007). Tambien se identifico la secuencia del motivo denominado caja lipasa [GA (C) SG], que es caracteristica de las sintasas. Se encontro el cambio que reporta la literatura de serina por cisteina en la caja lipasa [GX(C) XG] (Amara y Rehm, 2003; Jiang et al., 2004) (figura 3). Para la secuencia PhaC2 se encontraron identicos resultados que para la sintasa I (PhaC1), con excepcion en el motivo de la caja lipasa, en donde la serina posterior a la cisteina es reemplazada por una alanina [GA (C) AG] (figura 4). Lo anterior representa un cambio entre un aminoacido de tipo polar por uno de tipo apolar. No se encontro evidencias experimentales que comprueben la funcion de estos aminoacidos en la caja lipasa.

Hasta la fecha no se tiene evidencia suficiente que permita inferir la funcion exacta de los 8 residuos conservados. Sin embargo, se teoriza que la triada catalitica compuesta de Cys-Asp-His se encuentra en el nucleo de la estructura de todos los modelos tridimensionales generados para la PHA sintasas. Aunque para la estructura terciaria de las sintasas solo se ha obtenido por simulacion con otras proteinas (no se ha realizado cristalografia), si se conoce la funcion por mutaciones dirigidas de cada aminoacido de la triada, por lo que se afirma que el aminoacido que realiza la funcion catalitica es la cisteina, y que el acido aspartico y la histidina le dan estabilidad al complejo. Se conoce tambien el papel del triptofano que actua directamente en la interaccion proteina-proteina (Amara y Rehm, 2003; Jia et al., 2000; Muh et al., 1999; Nomura y Taguchi, 2007; Nuttawee et al., 2004; Rehm et al., 2002; Wodzinska et al., 1996).

[FIGURA 3 OMITIR]

Para realizar una aproximacion filogenetica de las proteinas PhaC1 y PhaC2 que codifican para sintasa tipo I y II respectivamente, se realizo un alineamiento multiple con CLUSTALW2, con secuencias de 6 cepas curadas y tomadas como referencia del GenBank (ver materiales y metodos). Se incluyo una cepa que posee sintasa tipo I (Burkholderia caryophylli /AF394660.1) y una cepa con sintasa tipo III (Alcanivorax borkumensis /YP_693138.1) control externo. Se observa en la figura 5 que la cepa IBUN S1602 se agrupa con Pseudomonas fluorecens con un puntaje de 99% para PhaC1 y de 100% para PhaC2. Lo que indica que las proteinas PhaC1 y PhaC2 de la cepa nativa IBUN S1602 tienen gran porcentaje de identidad con la cepa de referencia Pseudomonas fluorecens Pf0-1.

[FIGURA 4 OMITIR]

Se analizaron las secuencias PhaC1 y PhaC2 correspondientes en busca de dominios proteicos que revelan la familia a la que pertenece; se encontraron en las dos secuencias la presencia de dos dominios conservados, el primero (phaC_N) correspondiente a la superfamilia (pfam07167), que representa la region N- terminal de los microorganismos que producen polihidroxialcanoatos; la PhaC une monomeros de 3-hidroxibutiril-CoA para crear polimeros por la formacion de un enlace ester, aunque la region N-terminal de esta enzima no es muy estudiada si se han hecho estudios en donde se realizaron deleciones de este segmento, demostrando que la composicion del polimero se ve afectada ya que esta region puede estar relacionada con la especificidad del sustrato, esto se puede deber al cambio de configuracion de la enzima que afecta directamente la relacion con el sustrato, ademas se observa un cambio de polaridad que contribuye al mismo fenomeno (Ziqiang et al., 2007). El segundo dominio conservado encontrado, corresponde a la superfamilia de las [alfa]/[beta] hidrolasas (pfam00561), que involucra la funcion de la catalisis covalente, dos grupos tiol provistos por los residuos conservados de la cisteina; esta familia conserva la triada catalitica compuesta por (Cys-Asp-His) en donde la cisteina cumple el papel del aminoacido catalitico y el aspartato y la histidina dan estabilidad a la union de la proteina al sustrato. Tambien se muestran los multidominios pertenecientes a los tres tipos de sintasa, lo que es coherente ya que estas son similares entre si y cumplen la misma funcion (Akon et al., 2004; Amara y Rehm, 2003; Arpigny y Jaeger, 1999; Stubbe et al., 2003; Wahab et al., 2006).

[FIGURA 5 OMITIR]

[FIGURA 6 OMITIR]

[FIGURA 7 OMITIR]

Analisis de la prediccion estructura secundaria para los genes phaC1 y phaC2

El plegamiento regular de los aminoacidos dentro de la cadena polipeptidica forma la estructura secundaria de las proteinas. Se adopta gracias a la formacion de enlaces de hidrogeno entre las cadenas laterales (radicales) de aminoacidos cercanos en la cadena, los metodos de prediccion de estas estructuras se basan en el alineamiento multiple de las sintasas; se reporta que al menos el 72% de ellas poseen (39,9%) de [alfa]- helice, (10,4%) de [beta]-plegada y (49,7%) de giros variables, sin embargo la evidencia experimental muestra ligeros cambios entre las sintasas en cuanto a este tipo de estructura, por ejemplo Pseudomonas sp USM 4-55 presenta un 41,3% de [alfa]- helice, un 12,4% de [beta]-plegada y (46.3%) de giros variables, por lo tanto se sugiere que las sintasas tengan una estructura mixta entre ellas respecto a la prediccion de la estructura secundaria (Rehm, 2003). La region correspondiente al dominio de las [alfa]/[beta] hidrolasas no presenta ningun patron establecido de [alfa]- Helice y de [beta]-plegada (Wanab et al., 2006).

Los resultados de este analisis, mostraron que la secuencia de PhaC1 presento un 49,2% de [alfa]- helice, 11,4% de [beta]-plegada y 39,2 % de giros variables, y la secuencia PhaC2 presento un 52,3% de [alfa]- helice, 12,7 % de [beta]-plegada y 34,9 % de giros variables, a la vez en las dos secuencias la caja lipasa no presento una conformacion establecida acorde con lo reportado; se observo que la region del aminoacido 1 aproximadamente hasta el aminoacido 170 no presento ninguna representacion de [beta]-plegada, se busco en la literatura y se observo el mismo fenomeno (Wanab et al., 2006). Aunque se conservo la tendencia en los porcentajes representados, en su mayoria por a- helices, se observaron ciertas diferencias en la prediccion de la estructura secundaria entre las sintasas (PhaC1, PhaC2), y con las sintasas de otros microorganismos segun lo observado en la literatura; esto se puede atribuir a que estas enzimas a pesar de presentar una especificidad a cierto tipo de sustratos, estos sustratos son amplios, sugiriendo que los ligeros cambios le dan cierta flexibilidad requerida para ajustar su estructura al sustrato (figura 6 y 7).

Conclusiones

Se logro identificar la cepa IBUN S1602 como Pseudomonas fluorescens por medio de pruebas moleculares y bioquimicas, a su vez se determino que los analisis de la estructura primaria y secundaria tienen concordancia con lo que se reporta en la literatura para este tipo de enzimas, como la presencia de los ocho residuos conservados para las sintasas (S229; C287; G290; D319; W388; D442; G469; H470) y de la caja lipasa como caracteristica primordial de la familia de las a/p hidrolasas; se mostro tambien que en la estructura secundaria hay ligeros cambios entre ellas y con las reportadas, lo que sugiere que dichos cambios le dan esa flexibilidad requerida por ser tan versatiles a tan multiples sustratos. La maquinaria genetica, en cuanto a las sintasas se refiere de esta cepa, es muy similar a las reportadas, lo que indica que en cuanto a formacion de las sintasas y su posterior produccion de PHA puede ser utilizada en una cepa recombinante en estudios posteriores.

Agradecimientos

El presente trabajo se realizo en el grupo de Bioprocesos y Bioprospeccion y conto con el apoyo de los laboratorios de Microbiologia, Fermentaciones, Caucho, Virus Vegetales, Epidemiologia Molecular y Biopesticidas del Instituto de Biotecnologia de la Universidad Nacional de Colombia.

Recibido: septiembre 5 de 2011 Aprobado: noviembre 30 de 2011

Referencias bibliograficas

Akoh, C., Lee, G., Liaw, Y., Huang, T., Shaw, J. 2004. GDSL family of serine esterases/lipases. Progress in Lipid Research. 43(6):534-552.

Amara, A., Rehm, B. 2003. Replacement of the catalytic nucleophi le Cys-296 by serine in class II polyhydroxyalkanoate synthase from Pseudomonas aeruginosa mediated synthesis of a new polyester: identification of catalytic residues. Biochemical Journal. 374: 413-421.

Anderson, A., Dawes, E. 1990. Occurrence, metabolism, metabolic role, and industrial uses of bacterial polyhydroxyalkanoates. Microbiological reviews. 54(4):450-472.

Arias, S., Sandoval, A., Arcos, M., Canedo, LM., Maestro, B., Sanz, JM., Naharro, G., Luengo JM .2008. Poly-3-hydroxyalkanoate synthases from Pseudomonas putida U: substrate specificity and ultrastructural studies. Microbial Biotechnology.1(2):170-176.

Arpigny, J., Jaeger, K. 1999. Bacterial lipolytic enzymes: classification and properties Biochemical Journal.343:1 77-183.

Boskhomdzhiev, A., Bonartsev, A., Makhina, T., Myshkina, V., Ivanov, E., Bagrov, D., Filatova, E., Iordanskii, A., Bonartseva, G. 2010. Biodegradation kinetics of poly(3_hydroxybutyrate) based biopolymer systems. Biochemistry Supplement Series B: Biomedical Chemistry. 4(2): 177-182.

Braunegg, G., Lefebvre, G., Genser, K. 1998. Polyhydroxyalkanoates, biopolyesters from renewable resources: physiological and engineering aspects. Journal of Biotechnology. 65:127-161.

Chardron, S., Bruzaud, S., Lignot, B., Elain, A., Sire, O. 2010. Characterization of bionanocomposites based on medium chain length polyhydroxyalkanoates synthesized by Pseudomonas oleovorans, Polymer Testing. 29: 966-971.

Choi, J., Lee, S., Han, K. 1998. Clonning of the Alcaligenes latus polyhydroxyalkanoate biosynthesis genes and use of these genes for enhanced production of poly(3hydroxybutyrate) in Escherichia coli. Applied and Environmental Microbiology. 64: 4897-4903.

De Eugenio, LI., Garcia, P., Luengo, JM., Sanz, JM., San Roman, J., Garcia, JL., Prieto, MA. 2007. Biochemical evidence that phaZ gene encodes a specific intracellular medium-chain-length polyhydroxyalkanoate depolymerase in Pseudomonas putida KT2442 - Characterization of a paradigmatic enzyme. The Journal of Biological Chemistry. 282(7):4951-4962.

De Eugenio, L., Escapa, I., Morales, V., Dinjaski, N., Galan, B., Garcia, J., Prieto, M. 2010. The turnover of medium-chain-length polyhydroxyalkanoates in Pseudomonas putida KT2442 and the fundamental role of PhaZ depolymerase for the metabolic balance. Environmental Microbiology. 12(1): 207-221.

Dobroth, Z., Hu, S., Coats, E., McDonald, A. 2011. Polyhydroxybutyrate synthesis on biodiesel wastewater using mixed microbial consortia. Bioresource Technology. 102: 3352-3359.

Garcia, B., Olivera, E., Sandoval, A., Barrau, E., Arias, S., Naharro, G., Luengo, J. 2004.Strategy for cloning large gene assemblages as illustrated using the phenylacetate and polyhydroxyalkanoate gene clusters. Applied and environmental Microbiology. 70(8):5019-5025.

Hein, S., Sohling, B., Gottschalk, G., Steinbuchel, A. 1997. Biosynthesis of poly (4-hydroxybutyric acid) by recombinant strains of Escherichia coli. Federation of European Microbiological Societies Microbiology Letters. 153:411-418.

Jia, Y., Kappock, T., Frick, T., Sinskey, A., Stubbe, J. 2000. Lipases provide a new mechanistic model for polyhydroxybutyrate (PHB) synthases: characterization of the functional residues in Chromatium vinosum PHB synthase. Biochemistry. 39:3927-3936.

Jiang, Y., Ye, J., Wu, H., Zhang, H. 2004. Cloning and expression of the polyhydroxyalkanoate depolymerase gene from Pseudomonas putida, and characterization of the gene product. Biotechnology Letters. 26:1585-1588.

Marchessault, R., Dou, H., Ramsay, J. 2011. Microbial medium chainlength poly[(R)-3-hydroxyalkanoate] shows liquidcrystal behaviour. International Journal of Biological Macromolecules. 48: 271-275.

Moreno, L., Forero, M. 2004. Biosintesis de polimeros biodegradables del tipo poli-p-hidroxialcanoatos (PHAs) a partir de cepas nativas. Trabajo de Grado. Facultad de Ingenieria. Departamento de Ingenieria Quimica. Universidad Nacional de Colombia. Bogota, D.C. Colombia.

Moreno, N., Gutierrez, I., Malagon, D., Grosso, V., Revelo, D., Suarez, D., Gonzalez, J., Aristizabal, F., Espinosa, A., Montoya, D. 2007. Bioprospecting and characterization of poly-bhydroxyalkanoate (PHAs) producing bacteria isolated from Colombian sugarcane producing areas. African Journal of Biotechnology. 6(13):1536 -1543.

Muh, U., Sinskey, A., Kirby, D., Stubbe, J. 1999. PHB synthase from Chromatium vinosum: cysteine 149 is involved in covalent catalysis. Biochemistry. 38:826-837.

Nomura, C., Taguchi, S. 2007. PHA synthase engineering toward super biocatalysts for custom-made biopolymers. Applied Microbiology and Biotechnology. 73:969-979.

Nuttawee, N., Soazig, D., Young-Rok, K., Carl, B. 2004. Engineering of Chimeric Class II Polyhydroxyalkanoate Synthases. Applied and Environmental Microbiology. 70(11): 6789-6799.

Olivera, E., Carnicero, D., Garcia, B., Minambres, B., Moreno, M., Canedo, L., Concetta, C., DiRusso, Naharro, G., and Luengo, J., 2001. Two different pathways are involved in the b-oxidation of n-alkanoic and n-phenylalkanoic acids in Pseudomonas putida U: genetic studies and biotechnological applications. Molecular Microbiology. 39:863-874.

Olivera, E., Arcos, M., Naharro, G., and Luengo, J. 2010. Unusual PHA Biosynthesis. Plastic from Bacteria: Natural Functions and Applications. Edited by Chen, G. Microbiology Monographs. 14: 133-186.

Posada, J., Naranjo, J., Lopez, J., Higuita, J., Cardona, C. 2011. Design and analysis of poly-3-hydroxybutyrate production processes from crude glicerol. Process Biochemistry. 46: 310-317.

Ramsay, B., Lomaliza, K., Chavarie, C., Dube, B., Bataille, P., Ramsay, J. 1990. Production of poly-(p-hydroxybutyric-co-phydroxyvaleric) acids. Applied and Environmental Microbiology. 56: 2093-2098.

Rai, R., Keshavarz, T., Roether, J.A., Boccaccini, A., Roy, I. 2011. Medium chain length polyhydroxyalkanoates, promising new biomedical materials for the future. Materials Science and Engineering. 72: 29-47.

Rehm, B., Antonio, R., Spiekermann, P., Amara, A., Steinbuchel, A. 2002. Molecular characterization of the poly (3-hydroxybutyrate) (PHB) synthase from Ralstonia eutropha: in vitro evolution, site-specific mutagenesis and development of a PHB synthase protein model. Biochimica et Biophysica, Acta.1594:178-190.

Rehm, B. 2003. Review Article. Polyester synthases: natural catalysts for plastics. Biochemical Journal. 376: 15-33.

Rehm, B. 2006. Genetics and biochemistry of polyhydroxyalkanoate granule self-assembly: The key role of polyester synthases. Biotechnology Letters.28: 207-213.

Rehm, B. 2007. Biogenesis of microbial polyhydroxyalkanoate granules: a platform technology for the production of tailormade bioparticles. Current Issues in Molecular Biology. 9: 41-62.

Revelo, D., Grosso, M., Moreno, N., Montoya, D. 2007. A most effective method for selecting a broad range of short and medium chain- length polyhidroxyalcanoate producing microorganisms. Electronic Journal of Biotechnology. 10 (3): 348-35.

Sambrook, J., Fritsch, E., Maniatis, T. 1989. Molecular cloning. A laboratory manual. Cold Spring Harbor Laboratory, NY Second edition. Vol. 1, 2, 3.

Sandoval, A., Arias-Barrau, E., Arcos, M., Naharro, G., Olivera E., and Luengo J. 2007. Genetic and ultrastructural analysis of different mutants of Pseudomonas putida affected in the poly-3-hydroxyn-alkanoate gene cluster. Environmental Microbiology. 9:737-751.

Slawomir, C., Justyna, M., Grzegorz, P. 2010. The influence of nitrogen limitation on mcl-PHA synthesis by two newly isolated strains of Pseudomonas sp. Journal of Industrial Microbiology and Biotechnology. 37:511-520.

Stubbe, J., Tian, J. 2003. Polyhydroxyalkanoate (PHA) homeostasis: the role of the PHA synthase. Natural Product Reports. 20: 445-457.

Uribe, D. 2009. Informe final de proyecto: "Evaluacion de estrategias de control biologico para el manejo de Rhizoctonia solani y Spongospora subterranea en cultivos de papa". Ministerio de Agricultura y Desarrollo Rural y Asohofrucol. 78.

Wahab, H., Ahmad, Khairudin, N., Samian, M., Najimudin, N. 2006. Sequence analysis and structure prediction of type II Pseudomonas sp. USM 4-55 PHA synthase and an insight into its catalytic mechanism. BioMed Central Structural Biology. 6(23):2-14.

Weng, Y., Wang, X., Wang, Y. 2011. Biodegradation behavior of PHAs with different chemical structures under controlled composting conditions. Polymer Testing. 30: 372-380.

Wodzinska, J., Snell, K., Rhomberg, A., Sinskey, A., Biemann, K., Stubbe, J. 1996. Polyhydroxybutyrate synthase: evidence for covalent catalysis. Journal of the American Chemical Society. 118:6319-6320.

Wong, P., Chua, H., Lo, W., Lawford, H., Yu, P. 2002. Production of specific copolymers of polyhydroxyalkanoates from industrial waste. Applied Biochemistry and Biotechnology. 99: 641-654.

Ziqiang, Y., Ge, S., Guoqiang, C., Jingyu, C. 2007. Location of functional region at N-terminus of polyhydroxyalkanoate (PHA) synthase by N-terminal mutation and its effects on PHA synthesis. Biochemical Engineering Journal. doi:10.1016/j. bej.2008.03.006.

Julieth Serrano Riano *, Luz Angela Sastoque Rivera **, Dolly Montoya Castano ***, Nubia Moreno Sarmiento ****

* Instituto de Biotecnologia, Universidad Nacional de Colombia, Sede Bogota. Grupo de Bioprocesos y Bioprospeccion. juliethse@hotmail.com

** Instituto de Biotecnologia, Universidad Nacional de Colombia, Sede Bogota. Grupo de Bioprocesos y Bioprospeccion. sastoque99@yahoo.com

*** Instituto de Biotecnologia, Universidad Nacional de Colombia, Sede Bogota. Grupo de Bioprocesos y Bioprospeccion. dmontoyac@unal.edu.com

**** Depto. Ingenieria Quimica y Ambiental - Facultad de Ingenieria. Instituto de Biotecnologia, Universidad Nacional de Colombia, Sede Bogota. Grupo de Bioprocesos y Bioprospeccion. ncmorenos@unal.edu.co
COPYRIGHT 2011 Universidad Nacional de Colombia, Instituto de Biotecnologia
No portion of this article can be reproduced without the express written permission from the copyright holder.
Copyright 2011 Gale, Cengage Learning. All rights reserved.

Article Details
Printer friendly Cite/link Email Feedback
Title Annotation:ARTICULO DE INVESTIGACION
Author:Serrano Riano, Julieth; Sastoque Rivera, Luz Angela; Montoya Castano, Dolly; Moreno Sarmiento, Nubia
Publication:Revista Colombiana de Biotecnologia
Date:Dec 1, 2011
Words:5515
Previous Article:Identificacion de polimorfismos en RXam2, un gen candidato de resistencia a la bacteriosis vascular de yuca.
Next Article:Multiplicacion en sistema de inmersion temporal del clon de malanga "Viequera" (Xanthosoma spp.).
Topics:

Terms of use | Privacy policy | Copyright © 2019 Farlex, Inc. | Feedback | For webmasters