Printer Friendly

[alpha]-RgIB: a novel antagonist peptide of neuronal acetylcholine receptor isolated from Conus regius venom.

1. Introduction

Marine mollusks from Conus genus may produce from 50 up to 200 biologically active molecules that can be injected in the prey to capture or be employed as defense and/or escape mechanisms to deter competitors. The peptide toxins, called conopeptides, are composed of 10-40 amino acids (including nonnatural amino acids) and are abundant in the venom. Peptides presenting a rigid structure due to more than one disulfide bridges are common, being called conotoxins. These peptides act specifically on ionic channels and/or neuromuscular receptors [1, 2].

Conotoxins are classified according to three schemes: the similarities between the endoplasmatic reticulum signal sequence of the conotoxin precursors (gene superfamilies), the cysteine patterns of conotoxin mature peptide regions (cysteine frameworks), and the specificities to pharmacological targets (pharmacological families) [3, 4].

Conopeptides of the pharmacological family a, which acts on neuronal acetylcholine receptor, have been found in the A, D, L, M, and S gene superfamilies [5, 6].

Typically, [alpha]-conotoxins are peptides with 12 to 16 amino acid residues and two disulfide bridges, presenting the pattern CC-C-C. These peptides are competitive antagonists of the nicotinic acetylcholine receptors (nAChR) and display high selectivity by subtypes of this receptor [5, 7-9]. After the blockage of the muscular acetylcholine receptor, the [alpha]-conotoxins significantly decrease the amplitude of the motor end plate postsynaptic potentials in vertebrates, paralyzing the prey [10].

In the Brazilian tropical coast, there are approximately 18 species of cone snails [11]. Conus regius (Gmelin, 1791) is a vermivorous species that inhabits rock and coral deep waters of Florida (USA), Central America, and the Northeast and East coast of Brazil, including Fernando de Noronha archipelago [12].

In this work we described a novel peptide from Conus regius venom, belonging to the [alpha]-conotoxins family. This peptide blocks the neuronal acetylcholine receptors on PC12 cells, which comprise [alpha]3[beta]4 and/or [alpha]3[beta]4[alpha]5 subtypes receptors, probably target of the peptide.

2. Material and Methods

2.1. Reagents. All the employed reagents were of analytical grade and were purchased from Sigma Co (St Louis, MO, USA), unless otherwise stated.

2.2. Animals and Venom. Specimens of C. regius were collected at Fernando de Noronha Archipelago, Pernambuco, Brazil. The Brazilian Environmental Agency (IBAMA--Instituto Brasileiro do Meio Ambiente e dos Recursos Naturais Renovaveis) license numbers were 030/2000 and 087/2001, and the process number was 02001, 000775/00-00. Venom was extracted from the specimens as previously described [13]. The crude venom was obtained by dissection of the venom duct gland and then freeze-dried and stored at -80[degrees]C.

Voucher material is deposited in the malacological collection of Zoology Museum of University of Sao Paulo, Sao Paulo, Brazil.

2.3. Peptide Fractionation and Purification. A reversed-phase binary HPLC system (LC-8A, Shimadzu Co., Japan) was used for sample fractionation. The lyophilized crude venom powder was solubilized into 0.1% trifluoroacetic acid (TFA) and aliquots were loaded in a Shim-pack Prep-ODS C18 column (Shimadzu, 3 [micro]m, C18, 300 [Angstrom], 250 x 20 mm) in a two-solvent system: (A) trifluoroacetic acid (TFA)/[H.sub.2]O (1: 1000) and (B) TFA/Acetonitrile (ACN)/[H.sub.2]O (1:900: 100). The sample was eluted at a constant flow rate of 8 mL x [min.sup.-1] with a 0 to 60% gradient of solvent B over 60 min. The HPLC column eluates were monitored by a Shimadzu SPD10A detector scanning 220 nm.

For [alpha]-RgIB purification, the interest peak was fractionated in a Merck C18 column (300 x 4.6 mm), in a 19 to 21% B gradient over 20 min, at a constant flow rate of 8 mL x [min.sup.-1]. A subsequent purification step was still necessary to obtain the peptide. This purification was conducted in a Merck C18 column (300 x 4.6 mm), in an isocratic elution at 35% B (TFA/methanol/[H.sub.2]O 1:900:100) at a constant flow rate of 1mL x [min.sup.-1] .

2.4. Mass Spectrometry Analysis. Molecular mass analyses of the peaks and the peptides were performed on a micro LC-MS Ettan (Amersham Biosciences, Sweden) coupled in a Q-ToF Ultima API (Micromass, Manchester, UK) and/or by MALDI-TOF mass spectrometry on a Ettan MALDI-ToF/Pro System (Amersham Biosciences, Sweden).

The analysis in the micro-LC-MS Ettan (Amersham Biosciences, Sweden) was performed in a [micro]RPC C2/C18 ST 1.0/150 column (Amersham Biosciences, Sweden), with two solvents: (A) formic acid (FA)/[H.sub.2]O (1: 1000) and (B) FA/ACN/[H.sub.2]O(1:900:100). The sample was eluted at a constant flow rate of 50 [micro]L x [min.sup.-1] with a 5 to 65% gradient of solvent B over 60 min. Q-T of operated under positive ionization mode. For MALDI-TOF analyses, a-cyano-4-hydroxycinnamic acid was used as matrix.

2.5. "De Novo" Peptide Sequencing. Mass spectrometric "de novo" peptide sequencing was carried out in positive ionization mode on a Q-TOF Ultima API fitted with an electrospray ion source (Micromass, Manchester, UK). Briefly, the amounts of previously lyophilized peptide were dissolved in 50 mM ammonium acetate, reduced with 50 mM DTT, alkylated by 150 mM iodoacetamide, and hydrolyzed by 25 nM trypsin, according to slight modifications of Westermeier and Naven [14]. The reaction products were then lyophilized and dissolved in 50% ACN, containing 0.1% FA and injected into the source at 5 [micro]L-min-1 by a Hamilton infusion pump, or directly injected using a Rheodyne 7010 sample loop coupled to a LC-10A VP Shimadzu pump operating at 20 [micro]L-min-1 constant flow rate. The instrument control and data acquisition were conducted by Mass Lynx 4.0 data system (Micromass, Manchester, UK) and experiments were performed by scanning a mass-to-charge ratio (m/z)of 50-1800 using a scan time of 2 s applied during the whole chromatographic process. The mass spectra corresponding to each signal from the total ion current (TIC) chromatogram were averaged, allowing an accurate molecular mass determination. External calibration of the mass scale was performed with NaI. For the MS/MS analysis, collision energy ranged from 18 to 45 and the precursor ions were selected under a 1-m/z window.

2.6. Biological Activity. The biological activity of [alpha]-RgIB was determined in Swiss Webster mice (5.5 to 7g body weight) by observation of the behavioral disorders after intracranial injection [15] of the peptide diluted in NaCl 0.9%, in concentration of 0.1, 0.5 and 1 nmol. Alterations were compared to animals injected with NaCl 0.9% (control). All animals were observed by 60 min.

2.7 Patch Clamp. BC3H1 cells, mouse myocytes which express nicotinic acetylcholine receptors, were acquired by ATCC (CRL-1443) and maintained in culture according to Sine and Taylor [16] to electrophysiological experiments. In order to verify the subtype of neuronal nicotinic receptor that the peptide acts, PC12 cells were employed and maintained in culture according to Greene et al. [17].

Individual cells were subjected to a patch-clamp, at a whole cell configuration, according to Hamill et al. [18]and Urlich et al. [19]. Cells were maintained in an extracellular solution containing 25 mM HEPES, 5.3 mM KCl,144.8mM NaCl, 1.2 mM Mg[Cl.sub.2], 2.38 mM Ca[Cl.sub.2], and 10 mM glucose (pH 7.4). A recording electrode was filled with intracellular solution containing 25 mM HEPES, 141 mM KCl, 10 mM NaCl, 2mM Mg[Cl.sub.2] and 1mM EGTA (pH 7.4). Experiments were carried out at room temperature (20-24[degrees]C).

Throughout the experiment, the membrane potential was clamped at a -60 mV for B[C.sub.3][H.sub.1] cells and -70 mV for PC12 cells, holding potential using an Axon Axopatch amplifier (Molecular Devices, California, USA). Data were recorded and digitized by Clampex 8.2 software (Molecular Devices, California, USA) and plots were made using Origin 7.0 software (OriginLab Corp., Northampton, MA).

Control currents were performed with 1.5 mM carbamylcholine, using the cell-flow technique [20]. After the carbamylcholine administration, the peptide (10 [micro]M) was incubated on cells, and then another dose of the agonist was incubated [21].

2.8. Data Fitting, Statistical Analyses, and Sequence Alignment. When data fitting was performed, results were presented as the calculated value [+ or -] standard deviation (SD). Otherwise, data correspond to the mean of three individual experiments. Peptide sequence alignment was performed using Clustal W software [22]. The 3D model of the peptide [alpha]-RgIB, as well as three PDB deposited 3D solution structures, was created by I-TASSER [23, 24].

3. Results

3.1. Purification. The crude venom from C. regius was fractionated by RP-HPLC, as shown in Figure 1(a).Some peaks could be detected along the profile, and the arrow indicates the peak of interest. Two subsequent chromatographic steps were necessary to purify the peptide (Figures 1(b) and 1(c)), under the conditions described material and methods section. After the third step of purification, the purity and the molecular mass of the peptide were assessed by MALDI TOF/MS (Figure 1(d)).

3.2. "De Novo" Peptide Sequencing. After cysteine bridge reduction and alkylation, the reaction product was digested with trypsin. The obtained peptides were submitted to MS/MS analyses (Figure 2) and ions were selected and fragmented by collision with argon (CIF), yielding daughter ion spectra (Figure 3) that was processed with Bio Lynx and manually checked for accuracy of interpretation. Since the digestion allowed peptides with missed cleavage sites, it was possible to assemble the fragments without the aid of another digestion with a different enzyme. The sequenced peptides, their charge states, and theoretical molecular mass are presented in Table 1.

The peptide sequence was determined to be TWEECCKNPGCRNNHVDRCRGQV. This sequence has 4 cysteine residues with pattern CC-C-C, typical from conotoxins of framework I [25]. This peptide was named [alpha]-RgIB, according to the guidelines for conotoxins nomenclature ConoServer and has been assigned the following UNIPROT accession number: C0HJA8 [3, 6, 26].

3.3. Sequence Features. A sequence alignment was performed with all [alpha]-conotoxins available at UniProt (supplementary Table 1 of the supplementary material available online at http://dx.doi.org/10.1155/2013/543028). Based on this large alignment, a phylogeny was constructed (supplementary Figure 1) and the peptide sequences present at the branch containing [alpha]-RgIB were realigned (Figure 4). Clustal W standard annotations consider, as expected, the Cys residues as consensus (*), and the Glu at the 8th aligned position, as being highly conserved (:). Moreover, according to the algorithm standard notation, the Pro residue at the 13th aligned position is also conserved (.). Among the UNIPROT database, the Swiss Model tool could not identify any suitable template for structure prediction of [alpha]-RgIB, therefore an external application was used. Figure 5 presents a 3D model of [alpha]-RgIB; created by I-TASSER [23, 24], as well as three PDB deposited 3D solution structures of aRgIA (P0C1D0) mutants, a conotoxin that specifically and potently blocks the [alpha]9[alpha]10 nAChR [27]. In spite of [alpha]-RgIB N- and C-terminal extensions and longer interbridge peptide sequence, the model and the structures are tridimensionally related, for example, a C-shaped structure, held by the Cys-bridges.

3.4. Biological Activity. The in vivo biological activity of the peptide was assessed by means of intracranial injection in Swiss Webster mice. Following 1 nmol injection, the animals displayed a hyperactive behavior, defecating and urinating all the time, which was not observed for the control group that received saline solution. Auditory stimuli, for example, a hand-clap or hitting the cage, also triggered the hyperactive behavior. Interestingly, the lower doses (0.1 and 0.5 nmol), caused the animals to have difficulty in breathing. Although the peptide promoted behavioral disorders, it was not lethal to the animals.

3.5. Patch Clamp. Whole-cell voltage clamp measurement was used to verify the ion currents on acetylcholine receptors. BC3H1 cells, which express the acetylcholine muscle type receptors on the surface, and PC12, which terminally differentiate in neurons and express nicotinic neuronal receptors [21] were selected for the experiments. Carbamylcholine, a stable and well-characterized analogue of acetylcholine, was used as an agonist [28], for it elicits a fast activating current that rapidly desensitizes during the application.

10 [alpha]-RgIB was not able to induce any change in the ion currents on B[C.sub.3][H.sub.1] cells (data not shown), as well as a higher dose (30 [micro]M) of the peptide. d-tubocurarine (a classic nicotinic receptor antagonist) was used as a positive control and successfully to block this channel (data not shown).

After the incubation of the peptide with PC12 cells, fast and slow desensitization of the receptor was observed. Figure 6(b) shows that on neuronal slow rise-time receptors, [alpha]-RgIB is able to block the ion current by 40%, compared to cells stimulated with carbamylcholine (Figure 6(a)). The blockage was irreversible and persistent, once the current does not recover after a new application of the agonist, carbamylcholine (Figure 6(c)).

4. Discussion

Conotoxins are classified according to the similarities between the signal sequence of the conotoxin precursors (gene superfamilies), the cysteine patterns of conotoxin mature peptide regions (cysteine frameworks), and the specificities to pharmacological targets [3,4].

This new peptide was termed [alpha]-Rg-IB because the peptide acts on neuronal acetylcholine receptors ("[alpha]"), was extracted from a Conus regius specimen ("Rg"), displays a cysteine framework I--CC-C-C ("I"), and was the second peptide discovered with both being from C. regius with a cysteine framework I ("B") [25].

[alpha]-RgIB was the first a-conotoxin described from C. regius, acting on neuronal nicotinic receptors. This peptide has been thoroughly characterized in terms of its primary and three-dimensional structures [29], as well as regarding its biological effect, for example, the blockage of the a9al0 nAChR [30, 31]. [alpha]-RgIB and [alpha]-RgIB come from the same animal, belong to the same toxin family, and possess similar biological effects; however, their amino acid sequences differ. Figure 4 shows the Clustal W alignment of [alpha]-RgIB and its closest phylogenetic relatives (supplementary material), besides [alpha]-RgIB, which was not considered to be similar (according to MEGA5), but was manually inserted in the figure for the benefit of sequence comparison. [alpha]-RgIB is shorter, both in the N- and C-terminal flanking regions, as well as in the inter-Cys-bridge region. Nevertheless, in a considerably small universe of possibilities (8 out 12, since 4 amino acids are necessarily Cys), [alpha]-RgIB and [alpha]-RgIB bare considerable similarities: the Pro, at the 13th aligned position, and the charged residues at the 17th and 18th aligned positions. It is noteworthy to mention that, in spite of the phylogenetic analyses, all conotoxins listed in Figure 4 (except [alpha]-RgIB and [alpha]-RgIB) come from other Conus species: C. leopardus (A6M938, A1X8C2, A1X8C3), C. litteratus (Q2I2R6), C. pulicarius (P0C8U6, P0C8U7, P0C8U8, P0C8U9, and P0C8V0) and C. geographus (P01519). Moreover, only P01519 has been detected at the protein level and has been characterized as active on the muscular nicotinic receptors [32].

Besides [alpha]-RgIB, the following toxins have been isolated from C. regius: P85009; P85010; P85011; P85012; and P85013, all a-conotoxin-like peptides belonging to superfamily A; P85016; P85017; P85018; P85019; P85020; P85021 and P85022, all belonging to the M-superfamily of conotoxins [33]. Moreover, our group has also identified two conotoxins, as well:Rg11a,belongingtotheI1 superfamily (P84197, [34]); and Rg9.1, belonging to the P-superfamily (Q8I6V7; direct submission).

There is no high level of homology between [alpha]-RgIB and the conopeptides described until the present moment; therefore, the identification of a proper 3D structure to serve as a template for homology modeling is deprecated. Instead, a structure was predicted by using I-TASSER server [23, 24]. Figure 5 shows that, in spite of the low homology with [alpha]-RgIA, [alpha]-RgIB model assumed the same basic shape as the NMR determined structures of the [alpha]-RgIB mutants, available at the PDB database [27].

Regarding the rather unique amino acid sequence of [alpha]-RgIB and thoroughly analyzing our data, we could not rule out the possibility that one of the glutamic acid (Glu) residues of this novel conotoxin would be a gamma-carboxyglutamic acid residue (Gla). Our suspicions arouse from the slightly higher deviation between the theoretical and calculated molecular mass values for A and B ions (Table 1), that could reflect that a side chain carboxylation and not an N-terminal acetylation would be present. Moreover, conotoxins are known for presenting posttranslation modifications, Gla included [35-38] and, even though the MALDI data of the crude peptide support the proposed peptide sequence, MALDI ionization is also a source of facile decarboxylation for Gla residues [39]. Our future experiments with C. regius conotoxins ([alpha]-RgIB included) will clarify this matter.

[alpha]-conotoxins bind to nicotinic acetylcholine receptors. The subgroup [alpha]3/5 of [alpha]-conotoxins, from piscivorous Conus, has the motif CC[X.sub.3] C[X.sub.5] C and can cause paralysis of the prey by the binding on muscle nicotinic receptors. Another subgroup, [alpha]4/3, that present the motif CC[X.sub.4] C[X.sub.3] C, bind on neuronal nicotinic receptors. The main subgroup of [alpha]-conotoxins is [alpha]4/7, with motif CCX4 CX7C. These peptides bind in all classes of nicotinic receptors: muscular (e.g., [alpha]-conotoxin EI), homomeric neuronal (e.g., [alpha]-conotoxins PnIB), and heteromeric neuronal ([alpha]-conotoxins MII and AuIB) [9].

Neuronal nicotinic acetylcholine receptors (nAChRs) belong to the pentameric superfamily of Cys-loop ligand gated ionic channels. They are composed of either homomeric a or heteromeric [alpha] and [beta] subunits assembled from a family of 12 distinct neuronal nicotinic subunits ([alpha]2-[alpha]10; [beta]2-[beta]4) [5]. The combination of subunits [alpha]2, [alpha]3, and [alpha]4 with [beta]2 and [beta]4 results in a functional receptor, as well [alpha]7, [alpha]8, and [alpha]9 homomeric receptors [40, 41]. In our experiments, it was verified by RT-PCR (supplemental Figure 3) that the pool of PC12 cells expressed [alpha]3, [alpha]5, [alpha]7, [beta]2, and [beta]4 subunits of neuronal nicotinic receptors, the same pattern found by Sargent [40] in PC12 cells. However, inspite of [alpha]Rg-IB affinity by the PC12 nicotinic receptors, there are still other neuronal nicotinic receptors that may be higher affinity targets for these toxins that were not explored in the present work.

AuIB, from Conus aulicus, which is also an [alpha]-conotoxin, blocks the [alpha]3/[beta]4 receptors; however, the currents can be recovered after the toxin washing [42]. In our experiments, the no-recovery of [alpha]-RgIB is probably due to the irreversible action of the peptide on the receptor. Successive applications of the agonist (carbamolycholine), in control experiments, did not cause recovery of the ion currents on slow rise-time receptors (data not shown). Besides the irreversible action, the peptide may also be able to prolong the desensitization time of the receptor, since the repeated CBC administration on [alpha]-RgIB-treated PC12 cells was not able to recover the initial current, which is either caused by the irreversible binding of a low affinity toxin or the prolonging of the desensitization time of the receptor (or both).

Sudweeks and Yakel [43] showed that [alpha]3, [alpha]7, and [beta]2 subunits of nAChR are correlated to fast rise-time receptors. The slow desensitization is a characteristic of [alpha]3[beta]4 receptor, while [alpha]3[beta]2 receptor is from fast desensitization [44]. The fast desensitization receptors, on PC12 cells, contain [alpha]3[beta]2, [alpha]3[beta]2[alpha]5, and [alpha]7 subunits, while slow desensitization receptors are formed by subunits [alpha]3[beta]4 and [alpha]3[beta]4[alpha]5. [alpha]-RgIB was able to inhibit the currents elicited by carbamolycholine on PC12 cells, mainly on the slow desensitization component, which comprise, in our model, [alpha]3[beta]4and [alpha]3[beta]4[alpha]5 receptors.

The intracranial injection assay was performed to investigate whether there would be any direct activity of the toxin in the central nervous system (CNS), once peptides can promote behavioral alterations by acting on receptors and ionic channels on CNS. These alterations can indicate activities on specific ionic channels. For example, a)-conotoxin GVIA causes trembling on the mice, which indicates an action on calcium ionic channels [45]. The a-nicotinic acetylcholine receptor (nAChR) is associated to attention-deficit/hyperactivity disorder [46]which corroborates our observations of [alpha]-RgIB-treated hyperactive mice.

In conclusion, we have isolated a novel conotoxin from Conus regius and, by means of a combination of biochemical, structural and pharmacological assays were able to classify this peptide in the a-family and named it [alpha]-RgIB. There are still several peptides to be explored in the C. regius venom, as our previous qualitative investigations have shown [34] and the current study has focused on the biochemical characterization of one such novel peptide. Further studies are still necessary to better characterize the structural and pharmacological properties of [alpha]-RgIB.

http://dx.doi.org/10.1155/2013/543028

Acknowledgments

This work was supported by Grants from the Brazilian funding agencies FAPESP and CNPq, including the INCTTOX PROGRAM.

References

[1] B. M. Olivera and L. J. Cruz, "Conotoxins, in retrospect," Toxicon, vol. 39, no. 1, pp. 7-14, 2001.

[2] S.R. Woodward, L.J. Cruz, B.M. Olivera, and D.R. Hillyard, "Constant and hypervariable regions in conotoxin propeptides," The EMBO Journal, vol. 9, no. 4, pp. 1015-1020, 1990.

[3] Q. Kaas, R. Yu, A. H. Jin, S. Dutertre, and D.J. Craik, "ConoServer: updated content, knowledge, and discovery tools in the conopeptide database," Nucleic Acids Research, vol. 40, pp. D325-D330, 2012.

[4] Q. Kaas, J. C. Westermann, R. Halai, C. K. L. Wang, and D. J. Craik, "ConoServer, a database for conopeptide sequences and structures," Bioinformatics, vol. 24, no. 3, pp. 445-446, 2008.

[5] R. M. Jones, G. E. Cartier, J. M. McIntosh, G. Bulaj, V. E. Farrar, and B. M. Olivera, "Composition and therapeutic utility of conotoxins from genus Conus: patent status 1996-2000," Expert Opinion on Therapeutic Patents, vol. 11, no. 4, pp. 603-623,2001.

[6] Q.Kaas, J. C. Westerman, and D.J. Craik, "Conopeptide characterization and classifications: an analysis using ConoServer," Toxicon, vol.55, no.8, pp.1491-1509, 2010.

[7] O. B. McManus, J. R. Musick, and C. Gonzalez, "Peptide isolated from the venom of Conus geographus block neuromuscular transmission," Neuroscience Letters, vol. 25, no. 1, pp. 57-62,1981.

[8] B. M. Olivera, W. R. Gray, and L. J. Cruz, "Marinesnail venoms," in Marine Toxins and Venoms: Handbook of Natural Toxins, A. T. Tu, Ed., Marcel Dekker, New York, NY, USA, 1989.

[9] H. Terlau and B. M. Olivera, "Conus venoms: a rich source of novel ion channel-targeted peptides," Physiological Reviews, vol. 84, no 1, pp 41-68,2004

[10] H. R. Arias and M. P. Blanton, "[alpha]-conotoxins," International Journal of Biochemistry and Cell Biology, vol. 32, no. 10, pp. 1017-1028, 2000.

[11] E. C. Rios, Brazilian Marine Mollusks Iconography, Fundacao Universidade do Rio Grande, Rio Grande do Sul, Brazil, 1975.

[12] V. R. Eston, A. E. Migotto, E. C. Oliveira Filho, S. A. Rodrigues, and J. C. Freitas, "Vertical distribution of benthic marine organisms on rocky coasts of the Fernando de Noronha archipelago (Brazil)," Boletim do Instituto Paulista de Oceanografia, vol. 34, pp. 37-53, 1986.

[13] L. J. Cruz, G. Corpuz, and B. M. Olivera, "A preliminary study of Conus venom protein," The Veliger, vol. 18, pp. 302-308,1976.

[14] R. Westermeier and T. Naven, Proteomics in Practice: Laboratory Manual of Proteome Analysis, Wiley-VCH, Weinheim, Germany, 2002.

[15] C. Clark, B. M. Olivera, and L. J. Cruz, "A toxin from the venom of the marine snail Conus geographus which acts on the vertebrate central nervous system," Toxicon, vol.19, no.5, pp. 691-699, 1981.

[16] S. M. Sine and P. Taylor, "Functional consequences of agonist-mediated state transitions in the cholinergic receptor. Studies in cultured muscle cells," The Journal of Biological Chemistry, vol. 254, no. 9, pp. 3315-3325, 1979.

[17] L. A. Greene, J. M. Aletta, A. Rukenstein, and S. H. Green, "PC12 pheochromocytoma cells: culture, nerve growth factor treatment, and experimental exploitation," Methods in Enzymology, vol. 147, pp. 207-216,1987.

[18] O. P. Hamill, A. Marty, E. Neher, B. Sakmann, and F. J. Sigworth, "Improved patch-clamp techniques for high-resolution current recording from cells and cell-free membrane patches," Pflugers Archiv European Journal of Physiology, vol.391, no.2, pp.85-100, 1981.

[19] H. Ulrich, J. E. Ippolito, O. R. Pagan, V. A. Eterovic, R. M. Hann, H. Shi et al., "In vitro selection of RNA molecules that displace cocaine from the membrane-bound nicotinic acetylcholine receptor," Proceedings of the National Academy of Sciences of the United States of America, vol. 95, pp. 14051-14056,1998.

[20] J. B. Udgaonkar and G. P. Hess, "Chemical kinetic measurements of a mammalian acetylcholine receptor by a fast-reaction technique," Proceedings ofthe National Academy of Sciences of the United States of America, vol. 84, no. 24, pp. 8758-8762, 1987.

[21] A. A. Nery, R.R. Resende, A.H. Martins, C.A. Trujillo, V A. Eterovic, and H. Ulrich, "Alpha7 nicotinic acetylcholine receptor expression and activity during neuronal differentiation of PC12 pheochromocytoma cells," Journal of Molecular Neuro science, vol.41, no.3, pp.329-339,2010.

[22] M. A. Larkin, G. Blackshields, N. P. Brown, R. Chenna, P. A. McGettigan, and H. McWilliam, "Clustal W and Clustal X version 2," Bioinformatics, vol.23, pp.2947-2948,2007.

[23] A. Roy, A. Kucukural, and Y. Zhang, "I-TASSER: a unified platform for automated protein structure and function prediction," Nature protocols, vol.5, no.4, pp.725-738,2010.

[24] Y. Zhang, "Template-based modeling and free modeling by I TASSER in CASP7," Proteins, vol.69, no.S8, pp.108-117,2007.

[25] W. R. Gray, A. Luque, B. M. Olivera, J. Barrett, and L. J. Cruz, "Peptide toxins from Conus geographus venom," The Journal of Biological Chemistry, vol.256, no.10, pp.4734-4740,1981.

[26] B. M. Olivera, G. Bulaj, J. Garrett, H. Terlau, and J. Imperial, "Peptide toxins from the venoms of cone snails and other toxoglossan gastropods," in Animal Toxins: State of the Art-- Perspectives in Health and Biotechnology, M.E. Lima, Ed., Editora UFMG, Belo Horizonte, Brazil, 2009.

[27] M. Ellison, C. Haberlandt, M. E. Gomez-Casati et al., "[alpha]-RgIB: a novel conotoxin that specifically and potently blocks the a9a10 nAChR," Biochemistry, vol.45, no.5, pp.1511-1517,2006.

[28] C. Grewer and G. P. Hess, "On the mechanism of inhibition of the nicotinic acetylcholine receptor by the anticonvulsant MK801 investigated by laser-pulse photolysis in the microsecond to-millisecond time region," Biochemistry, vol.38, no.24, pp. 7837-7846, 1999.

[29] R. J. Clark, N. L. Daly, R. Halai, S. T. Nevin, D. J. Adams, and D. J. Craik, "The three-dimensional structure of the analgesic a-conotoxin, RgIA," FEBS Letters, vol.582, no. 5, pp.597-602, 2008.

[30] B. Callaghan, A. Haythornthwaite, G. Berecki, R. J. Clark, D. J. Craik, and D. J. Adams, "Analgesic [alpha]-conotoxins Vc1.1 and Rg1A inhibit N-type calcium channels in rat sensory neurons via GABAB receptor activation," Journal of Neuroscience, vol. 28, no.43, pp.10943-10951,2008.

[31] M. Ellison, Z. P. Feng, A. J. Park et al., "[alpha]-RgIB, a novel conotoxin that blocks the [alpha]9[alpha]10 nAChR: structure and identification of key receptor-binding residues," Journal of Molecular Biology, vol.377, no.4, pp.1216-1227,2008.

[32] D.R. Groebe, W.R. Gray, and S.N. Abramson, "Determinants involved in the affinity of [alpha]-conotoxins GI and SI for the muscle subtype of nicotinic acetylcholine receptors," Biochemistry, vol. 36,no 21,pp 6469-6474,1997

[33] A. Franco, K. Pisarewicz, C. Moller, D. Mora, G. B. Fields, and F. Marl, "Hyperhydroxylation: a new strategy for neuronal targeting by venomous marine molluscs," Progress in molecular and subcellular biology, vol. 43, pp. 83-103, 2006.

[34] M. C. V. Braga, K. Konno, F. C. V. Portaro et al., "Mass spectrometric and high performance liquid chromatography profiling of the venom of the Brazilian vermivorous mollusk Conus regius: feeding behavior and identification of one novel conotoxin," Toxicon, vol.45, no.1, pp.113-122, 2005.

[35] E. Czerwiec, D. E. Kalume, P. Roepstorff et al., "Novel [gamma]-carboxyglutamic acid-containing peptides from the venom of Conus textile" The FEBS Journal, vol. 273, no. 12, pp. 2779-2788, 2006.

[36] Q. Dai, Z. Sheng, J. H. Geiger, F. J. Castellino, and M. Prorok, "Helix-helix interactions between homo- and heterodimeric [gamma]-carboxyglutamate-containing conantokin peptides and their derivatives," The Journal of Biological Chemistry, vol. 282, no. 17, pp. 12641-12649, 2007.

[37] K. H. Gowd, V. Twede, M. Watkins et al., "Conantokin-P, an unusual conantokin with a long disulfide loop," Toxicon, vol. 52, no. 2, pp. 203-213, 2008.

[38] K. Hansson, B. Furie, B. C. Furie, and J. Stenflo, "Isolation and characterization of three novel Gla-containing Conus marmoreus venom peptides, one with a novel cysteine pattern," Biochemical and Biophysical Research Communications, vol.319, no. 4, pp. 1081-1087, 2004.

[39] T. Nakamura, Z. Yu, M. Fainzilber, and A. L. Burlingame, "Mass spectrometric-based revision of the structure of a cysteine-rich peptide toxin with y-carboxyglutamic acid, TxVIIA, from the sea snail, Conus textile," Protein Science, vol.5, no. 3, pp.524 530, 1996.

[40] P. B. Sargent, "The diversity of neuronal nicotinic acetylcholine receptors," Annual Review of Neuroscience, vol. 16, pp. 403-443, 1993.

[41] F. Wang, V. Gerzanich, G. B. Wellst et al., "Assembly of human neuronal nicotinic receptor [alpha]5 subunits with [alpha]3, [beta]2, and [beta]4 subunits," The Journal of Biological Chemistry, vol.271, no. 30, pp. 17656-17665, 1996.

[42] S. Luo, J. M. Kulak, G. E. Cartier et al., "a-conotoxin AuIB selectively blocks [alpha]3[beta]4 nicotinic acetylcholine receptors and nicotine-evoked norepinephrine release," Journal of Neuro science, vol. 18, no. 21, pp. 8571-8579, 1998.

[43] S. N. Sudweeks and J. L. Yakel, "Functional and molecular characterization of neuronal nicotinic ACh receptors in rat CA1 hippocampal neurons," Journal of Physiology, vol.527, no.3, pp. 515-528, 2000.

[44] S. Bohler, S. Gay, S. Bertrand et al., "Desensitization of neuronal nicotinic acetylcholine receptors conferred by N-terminal segments of the [beta] subunit," Biochemistry, vol. 40, no. 7, pp. 2066-2074, 2001.

[45] B. M. Olivera, L. J. Cruz, and D. Yashikami, "Effects of Conus peptides on the behavior of mice," Current Opinion in Neurobiology, vol.9, no.6, pp.772-777,1999.

[46] T. Dinklo, H.Shaban, J. W. Thuring et al., "Characterization of 2-[[4-fluoro-3-(trifluoromethyl)phenyl]amino]-4-(4pyridinyl)-5-thiazolemethanol (JNJ-1930942), a novel positive allosteric modulator of the a7 nicotinic acetylcholine receptor," Journal of Pharmacology and Experimental Therapeutics, vol. 336, no. 2, pp. 560-574, 2011.

Maria Cristina Vianna Braga, (1,2) Arthur Andrade Nery, (3) Henning Ulrich, (3) Katsuhiro Konno, (4) Juliana Mozer Sciani, (5) and Daniel Carvalho Pimenta (5)

(1) CAT/CEPID, Instituto Butantan, Avenida Vital Brasil 1500, 05503-900 Sao Paulo, SP, Brazil

(2) Ministerio da Ciencia, Tecnologia e Inovacao, Esplanada dos Ministerios, Bloco E, 70067-900 Brasilia, DF, Brazil

(3) Departamento de Bioquimica, Instituto de Quimica, Universidade de Sao Paulo, Av. Lineu Prestes 748, 05508-900 Sao Paulo, SP, Brazil

(4) Institute of Natural Medicine, University ofToyama, 2630 Sugitani, Toyama 930-0194, Japan

(5) Laboratirio de Bioquimica e Biofisica, Instituto Butantan, Avenida Vital Brasil 1500, 05503-900 Sao Paulo, SP, Brazil

Correspondence should be addressed to Daniel Carvalho Pimenta; dcpimenta@butantan.gov.br

Received 31 October 2012; Revised 16 January 2013; Accepted 16 January 2013

Academic Editor: Ayman El-Faham

TABLE 1: Theoretical and experimental m/z values for the tryptic
peptides obtained after the enzymatic digestion of [alpha]-RgIB.

Ions  [[M + H].sup.+]                [[M + 2H].sup.2+]
      Exp.           Theor.          Exp.          Theor.

A     1640.63 (1,2)  1639.839 (1,2)  820.82 (1,2)  820.423 (1,2)
B     1056.39 (1,2)  1055.180 (1,2)  528.70 (1,2)  528.094 (1,2)
C     754.37         754.359         377.69        377.896
D     619.30 (2)     619.298 (2)     --(3)         (310.366) (2,4)
E     603.28 (2)     603.267 (2)     --            (302.137)
F     335.16 (2)     335.147 (2)     --            x (5)

Ions  [[M + 3H].sup.3+]               Sequence
      Exp.            Theor.

A     547.55 (1,2)    547.282 (1,2)   TWEECCKNPGCR
B     --              x               TWEECCK
C     --              (252.125)       NNHVDR
D     --              x               CRGQV
E     --              x               NPGCR
F     --              x               CR

(1) Acetylation (N-terminal, variable modification).
(2) Carbamidomethyl cysteine (fixed modification).
(3) Not detected.
(4) Not observed.
(5) Not expected.

FIGURE 4: ClustalW alignment of [alpha]-RgIB and the closest
phylogenetic [alpha]-conotoxins relatives (calculated according to
supplemental Figure 3).(*) Consensus; (:) highly conserved; (.)
conserved. Amino acid indicated with #. residues of [alpha]-RgIB
were also considered to be conserved. A6M938:
[alpha]-conotoxin-like Lp1.10 C. leopardus/homology; A1X8C3:
[alpha]-conotoxin-like Lp1.7 C. leopardus/transcript; Q2I2R6:
[alpha]-conotoxin-like Lt1.3 C. litteratus/transcript; A1X8C2:
[alpha]-conotoxin-like Lp1.8 C. leopardus/transcript; P0C8U6:
[alpha]-conotoxin-like PuSG1.1 C. pulicarius/transcript; P0C8U9:
[alpha]-conotoxin-like Pu1.5 C. pulicarius/transcript; P0C8U8:
[alpha]-conotoxin-like Pu1.4 C. pulicarius/transcript;
P0C8U7/[alpha]-conotoxin-like PuSG1.2 C. pulicarius/trasncritpt;
P0C8V0: [alpha]-conotoxin-like Pu1.6 C. pulicarius/transcript;
P01519: [alpha]-conotoxin GIA C. geographus/protein; P0C1D0:
[alpha]-conotoxin RgIA, C. regius/protein. (Key: UniProt Accesion
code: toxin/Conus species/evidence level).

Clustal 2.1 multiple sequence alignment

[alpha]-RgIB    #----TWEECCKNPGCRNNHVDRCRGQV---------------#    23
A6M938          #------NDCCHNAPCRNNHPGIC-------------------#    17
A1X8C3          #---GMWDECCDDPPCRQNNMEHCPAS----------------#    23
Q2I2R6          #-------ECCDDPPCRQNNMEHCPAS----------------#    19
A1X8C2          #---GVWDECCKDPQCRQNHMQHCPAR----------------#    23
P0C8U6          ------DDCCPDPACRQNHPELCSTR----------------      20
P0C8U7          #------DDCCPDPACRQNHPEICPSR----------------#    20
P0C8U9          NAWLTPEECCAAPACREMILEFCLAGEAFAAALDGFRRLPYR      42
P0C8U8          NAWFTPEECCAAPACRGMILEFCLAGEAFAAALDGFRRLPYR      42
P0C8V0          ISEMTWEECCTNPVCRQHYMHYC-------------------      23
P01519          #-------ECC-NPACGRHYS-C-------------------#     13
                : ** . *              *
P0C1D0          GCCSDPRCRYR           C                         12
COPYRIGHT 2013 Hindawi Limited
No portion of this article can be reproduced without the express written permission from the copyright holder.
Copyright 2013 Gale, Cengage Learning. All rights reserved.

Article Details
Printer friendly Cite/link Email Feedback
Title Annotation:Research Article
Author:Braga, Maria Cristina Vianna; Nery, Arthur Andrade; Ulrich, Henning; Konno, Katsuhiro; Sciani, Julia
Publication:International Journal of Peptides
Article Type:Report
Geographic Code:4EUSW
Date:Jan 1, 2013
Words:5562
Previous Article:Total chemical synthesis of a heterodimeric interchain bis-lactam-linked peptide: application to an analogue of human insulin-like peptide 3.
Next Article:Nociceptin signaling involves a calcium-based depolarization in Tetrahymena thermophila.
Topics:

Terms of use | Privacy policy | Copyright © 2019 Farlex, Inc. | Feedback | For webmasters