Printer Friendly
The Free Library
14,457,282 articles and books
Member login
User name  
Password 
 
Join us Forgot password?

Botulinum neurotoxin detection and differentiation by mass spectrometry.


Botulinum bot·u·li·num or bot·u·li·nus
n.
An anaerobic, rod-shaped bacterium (Clostridium botulinum) that secretes botulin and inhabits soils.
 neurotoxins (BoNTs) are proteases that cleave cleat, cleave

claw of any cloven-footed animal.
 specific cellular proteins essential for neurotransmitter release. Seven BoNT serotypes (A-G A-G Air-to-Ground ) exist; 4 usually cause human botulism botulism (bŏch`əlĭz'əm), acute poisoning resulting from ingestion of food containing toxins produced by the bacillus Clostridium botulinum.  (A, B, E, and F). We developed a rapid, mass spectrometry--based method (Endopep-MS) to detect and differentiate active BoNTs A, B, E, and F. This method uses the highly specific protease protease /pro·te·ase/ (pro´te-as) endopeptidase.

pro·te·ase
n.
Any of various enzymes, including the proteinases and peptidases, that catalyze the hydrolytic breakdown of proteins.
 activity of the toxins with target peptides specific for each toxin serotype serotype /se·ro·type/ (ser´o-tip) the type of a microorganism determined by its constituent antigens; a taxonomic subdivision based thereon.

se·ro·type
n.
See serovar.

v.
. The product peptides derived from the endopeptidase endopeptidase /en·do·pep·ti·dase/ (-pep´ti-das) protease; any peptidase that catalyzes the cleavage of internal bonds in a polypeptide or protein.

en·do·pep·ti·dase
n.
 activities of BoNTs are detected by matrix-assisted laserdesorption ionization ionization: see ion.
ionization

Process by which electrically neutral atoms or molecules are converted to electrically charged atoms or molecules (ions) by the removal or addition of negatively charged electrons.
 time-of-flight mass spectrometry This article is about the mass spectrometry technique. For other uses, see time-of-flight.
Time-of-flight mass spectrometry (TOF-MS) is method of mass spectrometry in which ions are accelerated by an electric field of known strength.
. In buffer, this method can detect toxin equivalents of as little as 0.01 mouse lethal dose lethal dose
n. Abbr. LD
The dose of a chemical or biological preparation that is likely to cause death.
 [(MLD MLD median lethal dose; minimum lethal dose.

MLD or mld
abbr.
minimal lethal dose


MLD,
n See dose, lethal, minimum.


MLD

minimum lethal dose.
).sub.50] and concentrations as low as 0.62 [MLD.sub.50]/mL. A high-performance liquid chromatography--tandem mass spectrometry mass spectrometry
 or mass spectroscopy

Analytic technique by which chemical substances are identified by sorting gaseous ions by mass using electric and magnetic fields.
 method for quantifying active toxin, where the amount of toxin can be correlated to the amount of product peptides, is also described.

**********

Botulinum neurotoxins (BoNTs) are the most toxic substances known (1). They are produced under anaerobic anaerobic /an·aer·o·bic/ (an?ah-ro´bik)
1. lacking molecular oxygen.

2. growing, living, or occurring in the absence of molecular oxygen; pertaining to an anaerobe.
 conditions by strains of Clostridium botulinum Clostridium bot·u·li·num
n.
A bacterium that occurs widely in nature and is a cause of botulism; its six main types, A to F, are characterized by antigenically distinct but pharmacologically similar, very potent neurotoxins.
, C. butyricum, and C. baratii (1). Intoxication intoxication, condition of body tissue affected by a poisonous substance. Poisonous materials, or toxins, are to be found in heavy metals such as lead and mercury, in drugs, in chemicals such as alcohol and carbon tetrachloride, in gases such as carbon monoxide, and  with 1 of the 7 distinct serotypes of BoNT (A-G) causes botulism. One of 4 serotypes of BoNT (A, B, E, and F) is usually the cause of botulism in humans. BoNTs are zinc metalloproteases that cleave and inactivate in·ac·ti·vate
v.
1. To render nonfunctional.

2. To make quiescent.



in·acti·va
 specific cellular proteins essential for the release of the neurotransmitter acetylcholine acetylcholine (əsēt'əlkō`lēn), a small organic molecule liberated at nerve endings as a neurotransmitter. It is particularly important in the stimulation of muscle tissue.  (Figure 1). BoNT-A, -C, and -E cleave SNAP (synaptosomal-associated protein)-25; BoNT-B, -D, -F, and -G cleave synaptobrevin 2 (also called VAMP 2). Of the serotypes, only 1, BoNT-C, cleaves >1 site on a specific protein. In addition to cleaving SNAP-25, BoNT-C also cleaves syntaxin (1).

[FIGURE 1 OMITTED]

Current methods for detecting BoNT include a mouse bioassay Bioassay

A method for the quantitation of the effects on a biological system by its exposure to a substance, as well as the quantitation of the concentration of a substance by some observable effect on a biological system.
 (2-4) and an enzyme-linked immunosorbent assay enzyme-linked immunosorbent assay
n.
ELISA.


Enzyme-linked immunosorbent assay (ELISA)
A diagnostic blood test used to screen patients for AIDS or other viruses.
 (ELISA ELISA (e-li´sah) Enzyme-Linked Immuno-Sorbent Assay; any enzyme immunoassay using an enzyme-labeled immunoreactant and an immunosorbent.

ELISA
n.
) (5,6). The mouse bioassay is the accepted standard and is the only widely accepted method for detecting BoNY (2-5). In this assay, mice receiving an intraperitoneal injection containing a sample with more than a minimum lethal dose Minimum lethal dose (MLD, also LDmin) is the least amount of drug that can produce death in a given animal species under controlled conditions. Related Concept
  • LD50
 show symptoms of botulinum intoxication and die (2,4). Many institutional animal care and use committees, including that of the Centers for Disease Control and Prevention Centers for Disease Control and Prevention (CDC), agency of the U.S. Public Health Service since 1973, with headquarters in Atlanta; it was established in 1946 as the Communicable Disease Center. , require mice to be euthanized after the onset of severe symptoms. In the mouse bioassay, when the injected dose is high, mice typically develop signs of botulism within 8 hours. At lower doses, mice are affected more slowly; hence, mice are observed for 4 days before a negative result is recorded. The mouse bioassay can also be used to differentiate BoNT serotypes (4). Mixtures of neutralizing antibodies are given to mice in conjunction with the sample. Mice receiving the appropriate anti-BoNT serotype antibody are asymptomatic and survive, while mice treated with the other serotype antibodies show symptoms of botulism (4). The mouse bioassay measures active toxin and is sensitive. The absolute amount of toxin detected in the mouse bioassay is not well defined but is thought to be 10-20 pg/mL for BoNT A (7,8). The main disadvantage of the mouse bioassay is that it requires euthanizing many animals. It also requires several days to determine the toxin level and type (4-6). Special animal facilities are also required, personal hazards are associated with injecting animals (5,6), and some clostridia clostridia

members of the genus Clostridium.


enterotoxic clostridia
produce enterotoxins. See also enterotoxemia.

histotoxic clostridia
 produce nonbotulinal toxins that also kill mice (5).

The ELISA is more rapid than the mouse bioassay, but it is not a functional assay. It recognizes protein antigenic sites and in general is somewhat less sensitive than the mouse bioassay (5,6). The ELISA was validated for detecting BoNT produced in cooked meat medium and tryptone peptone peptone /pep·tone/ (pep´ton) a derived protein, or a mixture of cleavage products produced by partial hydrolysis of native protein.pepton´ic

pep·tone
n.
 glucose yeast extract (TPGY). The test was designed to detect and differentiate BoNT serotypes A, B, E, and F in a 1-day test and has the sensitivity of [approximately equal to] 10 mouse lethal dose [(MLD).sub.50]/mL (5,6). In a recent study, the ELISA performed well in most laboratories at the 100 [MLD.sub.50]/mL and 10,000 [MLD.sub.50]/mL levels (5). In this study, some cross-reactivity occurred among BoNT cultures and with nonbotulinum cultures (5). At 100 [MLD.sub.50]/mL, a >7% false-negative rate in TPGY was observed; at 10,000 [MLD.sub.50]/mL, a 1.5% false-positive rate for BoNT-A and a 28.6% false-positive rate for BoNT-F occurred (5). The ELISA is currently used primarily as a fast screening technique, and results are verified by the mouse bioassay (5).

Several in vitro in vitro /in vi·tro/ (in ve´tro) [L.] within a glass; observable in a test tube; in an artificial environment.

in vi·tro
adj.
In an artificial environment outside a living organism.
 assays have been developed to detect the activities of the different BoNT serotypes (7-14). This approach has led to methods that are based on the natural substrates that are cleaved cleaved (klevd) split or separated, as by cutting.  by the BoNTs and use fluorescence to detect toxin activity. These types of assays are >2 orders of magnitude less sensitive than the mouse bioassay and have not been proven for use with environmental, food, or clinical samples. They are also prone to giving false-positive results in samples that contain proteases because the specific site of cleavage cannot easily be determined in a fluorescence-based assay (15). Another method that combines immunoaffinity chromatography with specific antibodies for cleavage products has been successful in detecting BoNT B in some foods at lower detection limits than the mouse bioassay (10).

We introduce here the concept and preliminary data on a new, rapid, mass spectrometry-based, functional method for detecting, differentiating, and quantifying 4 BoNT serotypes. This method is based on both the unusual endopeptidase activities of these enzymes and specific detection of the unique peptide products by mass spectrometry (Endopep-MS). Because each BoNT serotype has a unique cleavage site cleavage site
n.
See restriction site.
 on a unique peptide, the mass-specific product peptides detected by mass spectrometry differentiate active BoNT serotypes. Substrate peptides that are specific for each serotype are incubated with BoNT; then serotype-specific product peptides are detected by either matrix-assisted laser-desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS) or by high-performance liquid chromatography (HPLC HPLC high-performance liquid chromatography.

HPLC

high performance liquid chromatography.

HPLC High-performance liquid chromatography Lab instrumentation A highly sensitive analytic method in which analytes are placed
)-electrospray ionization-tandem mass spectrometry (HPLC-ESI/MS/MS). Thus, this method combines the biologic specificity of the BoNT enzymatic activity with the unparalleled detection specificity of mass spectrometry.

Methods

Materials

BoNT complex toxins were purchased from Metabiologics (Madison, WI, USA) and were provided at 1 mg/mL total protein in 50 mmol/L sodium citrate buffer, pH 5.5. The toxin activities in [MLD.sub.50]/mg protein were 3.6 x [10.sup.7] BoNT-A, 1.6 x [10.sup.7] BoNT-B, 2.8 x [10.sup.7] BoNT-E, and 5.5 x [10.sup.7] BoNT-F. All reagents were from Sigma-Aldrich (St. Louis, MO, USA), except where indicated. HPLC-purified peptide substrates were synthesized by Los Alamos National Laboratory Los Alamos National Laboratory (LANL) (previously known at various times as Site Y, Los Alamos Laboratory, and Los Alamos Scientific Laboratory) is a United States Department of Energy (DOE) national laboratory, managed and operated by Los Alamos National  (Los Alamos, NM, USA). Figure 2 shows the peptide sequences used to detect and differentiate each BoNT serotype along with the specific cleavage products and their masses.

[FIGURE 2 OMITTED]

Peptide Cleavage Reactions

For the Endopep-MS method, BoNT serotypes A, B, E, and F endopeptidase activities were determined in 20-[micro]L volumes of buffer containing 0.05 mol/L Hepes (pH 7.3), 25 mmol/L dithiothreitol (DTT DTT Deloitte Touche Tohmatsu (Deloitte & Touch Global Operations)
DTT Dithiothreitol (cytology reagent)
DTT Digital Terrestrial Television
DTT Discrete Trial Training
), 20 mmol/L Zn[Cl.sub.2], 1 mg/mL bovine serum albumin serum albumin
n.
See seralbumin.
 (BSA 1. BSA - Business Software Alliance.
2. BSA - Bidouilleurs Sans Argent.
), and the target peptides, at 1 nmol each. Specific BoNT serotype complexes were added at various concentrations and incubated at 37[degrees]C from 2 h to 16 h. Control tubes without BoNT were run at the same time as BoNT cleavage reactions and served as an analytic blank. The analytic sensitivity of the reaction was tested by diluting the toxin in Hepes reaction buffer to 100, 10, 1, 0.1, and 0.01 [MLD.sub.50]/[micro]L. An aliquot aliquot (al-ee-kwoh) adj. a definite fractional share, usually applied when dividing and distributing a dead person's estate or trust assets. (See: share)  (1 [micro]L) of each dilution was added to 19 [micro]L reaction buffer containing specific peptides 1-4.

Multiplexing Reactions

Endopeptidase reactions were multiplexed by adding all 4 peptides (1-4) at 1 nmol each to the reaction buffer described above and incubating for 2 h at 37[degrees]C. Each BoNT serotype was added to separate reaction mixtures. Control tubes with no BoNT were always run at the same time to serve as an analytic blank. High levels of BoNT (200 ng/20 [micro]L reaction) were used for each serotype to look for cross-reactivity between any of the BoNT serotypes. No cross-reactivity between the various BoNT serotypes was observed.

Detection Limits in [MLD.sub.50]/mL

Larger volume reactions were run to test the sensitivity in mouse [LD.sub.50]/mL. BoNT serotype A, B, E, or F complexes ranging from 100 to 0.31 [MLD.sub.50] were spiked in 1 mL of deionized water. A 168-[micro]L aliquot was spiked with a 10x reaction buffer and peptide solution to yield final concentrations identical to those above. The target peptides used for this experiment were the same as above, except minor modification to the BoNT A and B substrate peptides were used since they showed slightly more activity than the previous peptides. These peptides were Biotin-([epsilon])-KGSNRTRIDEGNQRATR(Nle)LGGK-([epsilon])-Biotin for BoNT A and LSELDDRADALQAGASQFESSAAK-LKRKYWWKNLK for BoNT B. The final reaction volumes were 200 [micro]L. One set of reactions was allowed to proceed for 4 h, and a second set proceeded for 16 h. The longer reaction times were used to enhance the amount of product peptide produced and, therefore, lower the detection limits. For MALDI-TOF MALDI-TOF Matrix Assisted Laser Desorption Ionization - Time of Flight  analysis, 2 [micro]L of the 200-[micro]L reaction mixture was mixed with the matrix and analyzed as discussed in the MALDI-TOF-MS section. For HPLC-ESI/MS/MS analysis, 50 [micro]L of the 200-[micro]L reaction mixture was injected on the instrument.

MALDI-TOF-MS Analysis

Specific cleavage products were detected by mass spectrometry. For all experiments, the reaction mixture, at the incubation times indicated, was added to alpha-cyano-4-hydroxy cinnamic acid (CHCA CHCA Cincinnati Hills Christian Academy (Cincinnati, OH)
CHCA Child Health Corporation of America (Shawnee Mission, KS)
CHCA Canadian Home Care Association
CHCA Community Health Centers of Arkansas, Inc.
) at 5 mg/mL in 50% acetonitrile acetonitrile /ac·e·to·ni·trile/ (as?e-to-ni´tril) a colorless liquid with an etherlike odor used as an extractant, solvent, and intermediate; ingestion or inhalation yields cyanide as a metabolic product. , 0.1% trifluoroacetic acid, and 1 mmol/L ammonium citrate citrate /cit·rate/ (sit´rat) a salt of citric acid.

citrate phosphate dextrose  (CPD) anticoagulant citrate phosphate dextrose solution.
 (CHCA matrix), at a ratio of 1:5 or 1:10. This mixture was applied at 0.5 [micro]L per spot to a 192-spot stainless steel stainless steel: see steel.
stainless steel

Any of a family of alloy steels usually containing 10–30% chromium. The presence of chromium, together with low carbon content, gives remarkable resistance to corrosion and heat.
 MALDI MALDI Matrix-Assisted Laser Desorption/Ionization  plate (Applied Biosystems, Framingham, MA, USA). Mass spectra of each spot were obtained by scanning 650-4,500 m/z in MS-positive ion reflectron mode on a Model 4700 MALDI-TOF-TOF-MS Proteomics Analyzer (Applied Biosystems). The instrument used a nitrogen laser at 337 nm, and each spectrum was an average of 2,400 laser shots.

HPLC-ESI/MS/MS Analysis

The HPLC-ESI/MS/MS system consisted of an API4000 triple quadrupole A quadrupole is one of a sequence of configurations of electric charge or gravitational mass that can exist in ideal form, but it is usually just part of a multipole expansion of a more complex structure reflecting various orders of complexity.  mass spectrometer with a TurbolonSpray interface (Applied Biosystems, Toronto, Canada) and a Shimadzu (Kyoto, Japan) liquid chromatograph chromatograph /chro·mato·graph/ (kro-mat´o-graf)
1. the apparatus used in chromatography.

2. to analyze by chromatography.


chromatograph

1. to analyze by chromatography.

2.
. We used Luna C18 (Phenomenex, Torrance, CA, USA) columns (150 mm x 1 mm internal diameter, 5-[micro]m particles). Solvents were A: [H.sub.2]O with 1% (vol/vol) formic acid formic acid or methanoic acid (mĕth'ənō`ĭk), HCO2H, a colorless, corrosive liquid with a sharp odor; it boils at 100.7°C; and solidifies at 8.4°C;.  and B: 80:20 acetonitrile:[H.sub.2]O plus 1% (vol/vol) formic acid. Peptides were eluted with a linear gradient of 0% to 80% solvent B in 25 min, at 50 [micro]L/min. A parallel column format was used, giving a cycle time of 34 min. Tandem MS was performed by monitoring precursor to product transitions under individually optimized conditions, typically from the most abundant [[M+nH].sup.n+] precursor ion to an ammonium ion. For BoNT-A, the N-terminal product 1699.9 m/z, triply charged ion (567.5 m/z) fragmenting to 84 m/z, was monitored. For BoNT-B, the doubly charged ion (880.7 m/z) fragmenting to 84 m/z was monitored. For BoNT-E, the C-terminal product (705.8 m/z), doubly charged ion 353.7 [right arrow] 84.0 amu, was monitored. For BoNT-F, the triply charged ion (587.6 m/z) fragmenting to 84.1 m/z was monitored. All reaction runs and transitions were monitored for the entire 32-min run time. Isotopically labeled product peptides for BoNT-A (432 m/z [right arrow] 70 m/z and 368.8 m/z [right arrow] 70 m/z) were used as an internal standard for accurate quantification.

Results and Discussion

We developed a rapid, sensitive method for detecting and differentiating BoNT serotypes A, B, E, and F. Each BoNT serotype recognizes and cleaves a unique site on either SNAP-25 or VAMP-2 (Figure 1). We synthesized the specific portions of SNAP-25 and VAMP that are substrates for the 4 BoNT serotypes that commonly cause human botulism (serotypes A, B, E, and F). We used the endopeptidase activity to detect and differentiate the specific BoNT serotype by allowing the BoNT to cleave its specific peptide substrate and detecting the cleavage products by mass spectrometry.

The substrate peptides were designed to be the same as the sequences of those portions of the natural SNAP-25 (for BoNT-A and -E) or VAMP (for BoNT-B and -F) that are recognized and cleaved, except some modifications were made for BoNT-A and -B. For BoNT-A, the peptide from SNAP-25 that includes serine-187 to glycine-206 is required for cleavage at glutamine-196. Schmidt et al. found that replacing lysines 189 and 201 with arginines showed enhanced cleavage by BoNT-A (14). We also found an increase in the amount of BoNT-dependent cleavage products detected in the modified peptides. The portion of VAMP-2 required for cleavage by BoNT-B at glutamine-75 is leucine-59 to lysine-93, and the portion required for cleavage by BoNT-F at glutamine-57 is from alanine-36 to serine-74. The portion of SNAP-25 from isoleucine-156 to aspartic acid-186 is required for cleavage between arginine-180 and isoleucine-181 by BoNT-E. We biotinylated the N and C termini of the substrate peptide for BoNT-A so that the product peptides of interest can be easily purified from complex matrices. After final peptide sequences are determined, we plan to biotinylate all substrate peptides.

The method was multiplexed by combining all 4 substrate peptides for the BoNT serotypes A, B, E, and F into a sample that contained various levels of a single BoNT serotype or no toxin. The expected product peptide masses and the masses of the substrate peptides are shown in Figure 2. The product peptides for each specific BoNT serotype can be easily distinguished by their mass. The online Appendix Figure (http://www.cdc.gov/ncidod/EID/vol11 no10/04-1279_app.htm) shows typical results for each of the reaction mixtures containing the 4 substrate peptides incubated with only the reaction buffer (a blank) or with 1 of the BoNT serotypes. Each of the BoNT serotypes yielded only the expected cleavage products from its respective substrate peptides, indicating that this method can easily detect and differentiate active BoNT serotypes. No cleavage was observed in the reactions that did not contain BoNT. Additionally, even at this relatively high toxin level, no cross-reactivity was seen between the toxin types; only the expected peptide cleavage reactions were observed.

We also tested sensitivity of the method for each single toxin serotype with a single substrate peptide. Since enzymatic reactions tend to be concentration dependent, this testing was accomplished in 2 ways. First, we determined the sensitivity on the basis of the lowest absolute amount of toxin that could be detected by the Endopep-MS method in a 20-[micro]L reaction; second, we determined the lowest concentration per milliliter milliliter /mil·li·li·ter/ (mL) (-le?ter) one thousandth (10-3) of a liter.

mil·li·li·ter
n. Abbr.
 that could be detected by this method. The first approach indicates the minimum amount of toxin that needs to be present, and the second indicates the minimum concentration of toxin in a sample. For BoNT serotypes A, B, and F as little as 0.01 [MLD.sub.50] yielded sufficient quantities of product peptides to be clearly detected by MALDI-TOF-MS. This figure is 100x lower in the absolute amount of toxin than that required by the mouse bioassay. For BoNT-E, product peptides could be detected by MALDI-TOF-MS with as little as 0.08 [MLD.sub.50]. The analytic sensitivity of the method was then tested to determine the lowest measurable concentration of the toxin. An aliquot of a 1-mL sample that contained 100 [MLD.sub.50] to 0.31 mouse [LD.sub.50] in water was tested by both the MALDI-TOF-MS and HPLC-ESI/MS/MS methods. Reactions were also allowed to proceed for 4 h and for 16 h. The 4-h reactions for BoNT-A, -B, and -E showed the sensitivity by MALDI-TOF-MS detection of the product peptides of 1.2 mouse [LD.sub.50]/mL for BoNT-A and -B and 6.2 mouse [LD.sub.50]/mL for BoNT-E. After 16-h reactions, the sensitivity was 0.62 mouse [LD.sub.50]/mL for BoNT-A and -B, 0.31 mouse [LD.sub.50]/mL for BoNT-E, and 6.2 mouse [LD.sub.50]/mL for BoNT-F. Using HPLC-ESI/MS/MS to analyze these same low toxin samples, we found that after 16-h incubation, the detection limits were 0.62 mouse [LD.sub.50]/mL for BoNT-A and -B, <0.31 [MLD.sub.50]/mL for BoNT-E, and 0.62 [MLD.sub.50]/mL for BoNT-F. These data indicate that the Endopep-MS method is very sensitive with respect to the amount and concentration of toxin and that methods that can concentrate active toxins into smaller reaction volumes (thus yielding higher concentration) will result in lower limits of detection.

The HPLC-ESI/MS/MS technique to quantitatively detect and differentiate BoNT activities is highly selective. Correct identification of the BoNT product peptides depends on both a retention time match, with respect to standards, and on a chemical-specific fragmentation (a precursor to product ion multiple reaction monitoring [MRM MRM Marketing Resource Management
MRM Mobile Resource Management
MRM Metabolic Response Modifiers
MRM Multiple Reaction Monitoring (mass spectrometry)
MRM Mormonism Research Ministry
MRM Mechanically Recovered Meat
] transition) monitored by tandem MS. To further enhance selectivity, 2 separate MRM transitions can be monitored for each peptide. In addition, our HPLC-ESI/MS/MS technique is very sensitive. Quantification of the BoNT product peptides is achieved by using stable isotope-labeled internal standards that have the same sequence as the native product peptides but are labeled with 13C. Figure 3 shows typical HPLC-ESI/MS/MS chromatograms obtained during the quantification of the activity of BoNT-A, and a standard curve for both of the product peptides. The amount of product peptide was then correlated with the amount of toxin that yielded the product peptides. Standard curves between 10 and 1,000 [MLD.sub.50] were prepared, and individual spiked samples were run as unknown samples to determine the accuracy and precision of the method. The spiked samples were prepared at 16, 32, 65, and 125 [MLD.sub.50]; 2 samples were run in duplicate at each spike level giving a total of 4 measurements. The accuracy and precision of these measurements, shown in the Table, were good; relative standard deviations were <2%-5%. This method is the first that can accurately quantify BoNT enzymatic activity. Identical HPLC-ESI/MS/MS strategies can be used to quantify each of the BoNT serotypes.

[FIGURE 3 OMITTED]

The Endopep-MS method has many possible applications. Beyond using the Endopep-MS method for identifying the BoNT serotype in a clinical, food, or environmental sample, standardizing BoNT activity in samples used for clinical treatment or research activities may be possible. The standardization of BoNT, both the amount of 150-kDa toxin and the activity of a standard solution, is of great importance in the medical use of BoNT (16). A possible strategy for standardizing BoNT includes correlating the activity obtained by the mouse bioassay to the Endopep-MS method. Additionally, it may be possible to correlate this activity to an absolute amount of toxin that is determined in a similar fashion as was done for apolipoprotein apolipoprotein /apo·lipo·pro·tein/ (ap?o-lip?o-pro´ten) any of the protein constituents of lipoproteins, grouped by function in four classes, A, B, C, and E.

ap·o·lip·o·pro·tein
n.
 A-1 (17).

Endopep-MS currently has limitations. Mass spectrometry equipment is expensive and requires a high level of technical expertise for optimal operation. The method still needs to be tested in a wide variety of clinical and food samples and may require the use of protease inhibitors Protease Inhibitors Definition

A protease inhibitor is a type of drug that cripples the enzyme protease. An enzyme is a substance that triggers chemical reactions in the body.
 and affinity chromatography to partially purify and concentrate the toxin. Also, the Endopep-MS method needs to be validated against the mouse bioassay. The method also has several strengths. It is rapid, and in simple matrices, such as water and buffer, it can obtain similar sensitivities to the mouse in <5 h. Samples can be prepared for the reactions in minutes; incubation times of only 4 h yield sensitivity close to the mouse bioassay, and MALDI-TOF mass spectra can be collected in <1 min. Samples can also be batched so that 50 samples can be analyzed in <6 h. The HPLC-ESI/MS/MS analysis is somewhat slower than the MALDI-TOF-MS, and each sample requires 30 min. However, this process has been automated, and batches of samples can run unattended so that 40 samples a day can be processed and run by HPLC-ESI/MS/MS. The method is well suited for multiplexing and can not only detect but also differentiate toxin type in a single analytic run.

Conclusions

We developed a method based on the unusually specific endopeptidase activity of BoNT that uses highly selective mass spectrometry analysis to detect and differentiate BoNT serotypes A, B, E and F. This method is rapid and sensitive. When the endopeptidase reactions are allowed to proceed for 16 h, it is highly sensitive; 100x more sensitive in absolute amounts of active toxin for BoNT-A, -B, and -F and >10X more sensitive than the mouse bioassay for BoNT-E. Since each BoNT serotype has a unique cleavage site on a substrate peptide, this analysis lends itself well to multiplexing. We multiplexed the analysis and showed that no cross-reactivity occurs within the 4 BoNT serotypes. The Endopep-MS method should be very useful to rapidly detect and differentiate active BoNT in a variety of clinical, food, or environmental samples to quickly establish the serotype(s) and aid in identifying a source during an outbreak. It may also prove useful for standardizing BoNT enzymatic activity for preparations used as clinical treatments or for research activities. This type of approach may also prove useful for detecting other proteolytic pro·te·o·lyt·ic
adj.
Relating to, characterized by, or promoting proteolysis.


proteolytic (pro″teolit´ik),
adj
 toxins.

Acknowledgments

We thank Susan Maslanka for many helpful discussions and a thoughtful review of this manuscript and James Pirkle for his support and guidance throughout the method development.

References

(1.) Schiavo G, Matteoli M, Montecucco C. Neurotoxins affecting neuroexocytosis. Physiol Rev. 2000;80:717-66.

(2.) Centers for Disease Control and Prevention. Botulism in the United States, 1899-1996. Handbook for epidemiologists, clinicians, and laboratory workers. Atlanta: The Centers; 1998.

(3.) Arnon SS, Schechter R, lnglesby TV, Henderson DA, Bartlett JG, Ascher MS, et al. Botulinum toxin as botulinum toxin A Oculinum Neurology One of several toxins produced by C botulinum, of which the 150 kD type A toxin has been purified and used to treat various neuromuscular junction disorders including strabismus, blepharospasm, spasmodic torticollis,  a biological weapon: medical and public health management. JAMA JAMA
abbr.
Journal of the American Medical Association
. 2001:285:1059 70.

(4.) Official methods of analysis. 17th ed. Gathersburg (MD): AOAC International; 2000. Section 17.7.01. p. 68-70.

(5.) Ferreira J, Maslanka S, Johnson E, Goodnough M. Detection of botulinal botulinal /bot·u·li·nal/ (boch?u-li´n'l)
1. pertaining to Clostridium botulinum.

2. pertaining to botulinum toxin.


botulinal

pertaining to Clostridium botulinum or to its toxin.
 neurotoxins A, B, E, and F by amplified enzyme-linked immunosorbentassay: collaborative study. J AOAC AOAC Association of Official Analytical Chemists (now AOAC International)
AOAC Association of Analytical Communities
AOAC Association of Analytical Chemists
AOAC Always On/Always Connected
AOAC Aero-Optic Evaluation Center
 Int. 2003:86:314-31.

(6.) Ferreira JL, Eliasberg SJ, Edmonds P, Harrison MA. Comparison of the mouse bioassay and enzyme-linked immunosorbent assay procedures for the detection of type A botulinal toxin in food. J Food Prot. 2004;67:203-6.

(7.) Hallis B, James BAF BAF British Athletics Federation , Shone CC. Development of novel assays for botulinum type A and B neurotoxins based on their endopeptidase activities. J Clin Microbiol. 1996;34:1934-8.

(8.) Wictome M, Newton K, Jameson K, Hallis B, Dunnigan P, Mackay E, et al. Development of an in vitro bioassay tbr Clostridium botulinum type B neurotoxin neurotoxin /neu·ro·tox·in/ (noor´o-tok?sin) a substance that is poisonous or destructive to nerve tissue.

neu·ro·tox·in
n.
See neurolysin.
 in foods that is more sensitive than the mouse bioassay. Appl Environ Microbiol. 1999;65:3787-92.

(9.) Schmidt JJ, Bostian KA. Proteolysis proteolysis

Process in which a protein is broken down partially, into peptides, or completely, into amino acids, by proteolytic enzymes, present in bacteria and in plants but most abundant in animals.
 of synthetic peptides by type A botulinum neurotoxin. J Protein Chem. 1995;14:703-8.

(10.) Wictome M, Newton KA, Jameson K, Dunnigan P, Clarke S, Gaze J, et al. Development of in vitro assays for the detection of botulinum toxins in foods. FEMS Immunol Med Microbiol. 1999;24:319-23.

(11.) Ekong TAN, Feavers IM, Sesardic D. Recombinant SNAP-25 is an effective substrate tbr Clostridium botulinum type A toxin endopeptidase activity in vitro. Microbiology. 1997;143:3337-47.

(12.) Schmidt J J, Stafford RG, Millard CB. High-throughput assays for botulinum neurotoxin proteolytic activity: serotypes A, B, D, and F. Anal Biochem. 2001;296:130-7.

(13.) Anne C, Cornille F, Lenoir C, Roques Roques is the name or part of the name of several communes in France:
  • Roques, in the Haute-Garonne department
  • Roques, in the Gers department
 BE High-throughput fluorogenic assay for determination of botulinum type B neurotoxin protease activity. Anal Biochem. 2001;291:253-61.

(14.) Schmidt JJ, Stafford RG. Fluorogenic substrates for the protease activities of botulinum neurotoxins, serotypes A, B, and F. Appl Env Microbiol. 2003;69:297-303.

(15.) Shone CC, Roberts AK. Peptide substrate specificity and properties of the zinc-endopeptidase activity of botulinum type B neurotoxin. Eur J Biochem. 1994:225:263-70.

(16.) Sesardic D. Alternatives in testing of bacterial toxins and antitoxins. Dev Biol (Basel). 2002;111:101-8.

(17.) Barr JR, Maggio VL, Patterson DG, Henderson LO, Cooper GR, Hannon WH, et al. A new isotope dilution-mass spectrometric method for the quantitation of specific proteins: a model application using apolipoprotein A-1. Clin Chem. 1996:42:1676-82.

John R. Barr, * Hercules Moura, * Anne E. Boyer, * Adrian R. Woolfitt, * Suzanne R. Kalb, * Antonis Pavlopoulos, * Lisa G. McWilliams, ([dagger]) Jurgen G. Schmidt, ([double dagger]) Rodolfo A. Martinez, ([double dagger]) and David L. Ashley *

* Centers for Disease Control and Prevention, Atlanta, Georgia, USA; ([dagger]) Battelle Memorial Institute The Battelle Memorial Institute is a private not-for-profit applied science and technology development company headquartered in Columbus, Ohio. The institute opened in 1929 but traces its origins to the 1923 will of Ohio industrialist Gordon Battelle which provided for its , Atlanta, Georgia, USA; and ([double dagger]) Los Alamos National Laboratory, Los Alamos, New Mexico Los Alamos (Spanish: Los Álamos, meaning "The Cottonwoods") is an unincorporated townsite in Los Alamos County, New Mexico. The population of the townsite alone was 11,909 at the 2000 census. The townsite or "the hill" is one part of town while White Rock is also part of the town. , USA

Staff from Battelle Memorial Institute worked under contract at the Centers for Disease Control and Prevention, Atlanta, GA.

Dr Barr is chief of the Biological Mass Spectrometry Laboratory in the National Center for Environmental Health at the Centers for Disease Control and Prevention. His research interests include biologic monitoring, standardization of clinical measurements, and identification and quantification of chemical and biologic warfare agents with mass spectrometry.

Address for correspondence: John R. Barr, Centers for Disease Control and Prevention, 4770 Buford Hwy, Mailstop F47, Atlanta, GA 30341, USA; fax: 770-488-4609; email: jbarr@cdc.gov
Table. Accuracy of quantification of BoNT-A *

                                  Measured concentration mean
Spike level (mouse [LD.sub.50])       [+ or -] SD (N = 4)

16                                    19.85 [+ or -] 1.71
32                                    33.75 [+ or -] 3.24
65                                    68.05 [+ or -] 5.07
125                                  120.78 [+ or -] 2.66

* BoNT, botulinum neurotoxin, LD, lethal dose, SD, standard deviation.
COPYRIGHT 2005 U.S. National Center for Infectious Diseases
No portion of this article can be reproduced without the express written permission from the copyright holder.
Copyright 2005, Gale Group. All rights reserved. Gale Group is a Thomson Corporation Company.

 Reader Opinion

Title:

Comment:



 

Article Details
Printer friendly Cite/link Email Feedback
Author:Ashley, David L.
Publication:Emerging Infectious Diseases
Geographic Code:1USA
Date:Oct 1, 2005
Words:4284
Previous Article:Plasmodium falciparum spatial analysis, western Kenya highlands.
Next Article:Methicillin-resistant Staphylococcus aureus, Western Australia.
Topics:



Related Articles
Toxin to the rescue: tapping a deadly botulinum protein to treat neuromuscular disorders.
Botulinum toxin in otolaryngology: A review of its actions and opportunities for use.
INTERNATIONAL STANDARDS ACTIVITY IN POLYMER MASS SPECTROMETRY.(Brief Article)
INTERNATIONAL INTERLABORATORY TESTING ADVANCES MASS DISTRIBUTION MEASUREMENT METHOD FOR SYNTHETIC POLYMERS.(Brief Article)
NEW INTERNATIONAL STANDARDS ACTIVITY IN POLYMER MASS SPECTROMETRY.(Brief Article)
Quantitative synthetic polymer mass spectrometry workshop. (Conference Report).
Network will increase knowledge of analytical methods.
Detecting Clostridium botulinum.(Letter to the editor)
Effectiveness of repeated treatment with botulinum toxin type A across different conditions.

Terms of use | Copyright © 2009 Farlex, Inc. | Feedback | For webmasters | Submit articles